Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 3172921..3173621 | Replicon | chromosome |
Accession | NZ_CP102951 | ||
Organism | Pseudomonas sp. LS1212 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | NVV94_RS14770 | Protein ID | WP_258443141.1 |
Coordinates | 3173325..3173621 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | - |
Locus tag | NVV94_RS14765 | Protein ID | WP_258443140.1 |
Coordinates | 3172921..3173322 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NVV94_RS14745 (NVV94_14745) | 3169634..3171148 | + | 1515 | WP_258443136.1 | IS21 family transposase | - |
NVV94_RS14750 (NVV94_14750) | 3171166..3171921 | + | 756 | WP_258443137.1 | IS21-like element helper ATPase IstB | - |
NVV94_RS14755 (NVV94_14755) | 3172309..3172564 | - | 256 | Protein_2893 | hypothetical protein | - |
NVV94_RS14760 (NVV94_14760) | 3172605..3172898 | - | 294 | WP_258443138.1 | hypothetical protein | - |
NVV94_RS14765 (NVV94_14765) | 3172921..3173322 | - | 402 | WP_258443140.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
NVV94_RS14770 (NVV94_14770) | 3173325..3173621 | - | 297 | WP_258443141.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
NVV94_RS14775 (NVV94_14775) | 3173813..3174262 | + | 450 | WP_258443142.1 | VOC family protein | - |
NVV94_RS14780 (NVV94_14780) | 3174609..3176093 | - | 1485 | WP_258443143.1 | group II intron reverse transcriptase/maturase | - |
NVV94_RS14785 (NVV94_14785) | 3176720..3177270 | - | 551 | Protein_2899 | OprD family porin | - |
NVV94_RS14790 (NVV94_14790) | 3177443..3177724 | - | 282 | WP_258447711.1 | DUF2790 domain-containing protein | - |
NVV94_RS14795 (NVV94_14795) | 3178002..3178274 | - | 273 | WP_258443144.1 | hypothetical protein | - |
NVV94_RS14800 (NVV94_14800) | 3178275..3178475 | - | 201 | WP_258443145.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3154440..3178475 | 24035 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10845.57 Da Isoelectric Point: 6.8688
>T254584 WP_258443141.1 NZ_CP102951:c3173621-3173325 [Pseudomonas sp. LS1212]
MEKRTPHCKLSALKALTEAGKVRTTHAARVGANELGLELSDMLAVVMALTPADFYKSMTTHADHTIWQDVYRPSTQAGDV
YLKLTVIDDVLIVSFKEL
MEKRTPHCKLSALKALTEAGKVRTTHAARVGANELGLELSDMLAVVMALTPADFYKSMTTHADHTIWQDVYRPSTQAGDV
YLKLTVIDDVLIVSFKEL
Download Length: 297 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14570.87 Da Isoelectric Point: 7.6343
>AT254584 WP_258443140.1 NZ_CP102951:c3173322-3172921 [Pseudomonas sp. LS1212]
MKCPVCGAAELIRDTRDLPYTYKGETTVIAAVTGDFCPACAESVLDAVESDRVMREMRAFSKQVNAAIVDPGFITTVRKK
LALDQREAAEIFGGGVNAFSRYENGKTKPPLALVKLLKVLDRHPELLNEVRTA
MKCPVCGAAELIRDTRDLPYTYKGETTVIAAVTGDFCPACAESVLDAVESDRVMREMRAFSKQVNAAIVDPGFITTVRKK
LALDQREAAEIFGGGVNAFSRYENGKTKPPLALVKLLKVLDRHPELLNEVRTA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|