Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4820552..4821154 | Replicon | chromosome |
Accession | NZ_CP102947 | ||
Organism | Escherichia coli strain SCAID WND1-2022 (119) |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | NW339_RS23580 | Protein ID | WP_000897302.1 |
Coordinates | 4820843..4821154 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NW339_RS23575 | Protein ID | WP_000356397.1 |
Coordinates | 4820552..4820842 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW339_RS23545 (4815859) | 4815859..4816788 | + | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
NW339_RS23550 (4816970) | 4816970..4817212 | - | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
NW339_RS23555 (4817502) | 4817502..4818350 | + | 849 | WP_001038650.1 | hypothetical protein | - |
NW339_RS23560 (4818375) | 4818375..4819115 | + | 741 | WP_000608806.1 | hypothetical protein | - |
NW339_RS23565 (4819300) | 4819300..4819518 | - | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
NW339_RS23570 (4819915) | 4819915..4820193 | - | 279 | WP_001296612.1 | hypothetical protein | - |
NW339_RS23575 (4820552) | 4820552..4820842 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
NW339_RS23580 (4820843) | 4820843..4821154 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
NW339_RS23585 (4821383) | 4821383..4822291 | + | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
NW339_RS23590 (4822355) | 4822355..4823296 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NW339_RS23595 (4823341) | 4823341..4823778 | - | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
NW339_RS23600 (4823775) | 4823775..4824647 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
NW339_RS23605 (4824641) | 4824641..4825240 | - | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T254571 WP_000897302.1 NZ_CP102947:c4821154-4820843 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|