Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3602476..3603155 | Replicon | chromosome |
Accession | NZ_CP102947 | ||
Organism | Escherichia coli strain SCAID WND1-2022 (119) |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | NW339_RS17805 | Protein ID | WP_000057523.1 |
Coordinates | 3602853..3603155 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | NW339_RS17800 | Protein ID | WP_000806442.1 |
Coordinates | 3602476..3602817 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW339_RS17790 (3598720) | 3598720..3599652 | - | 933 | WP_000883041.1 | glutaminase A | - |
NW339_RS17795 (3599914) | 3599914..3602418 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
NW339_RS17800 (3602476) | 3602476..3602817 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
NW339_RS17805 (3602853) | 3602853..3603155 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NW339_RS17810 (3603288) | 3603288..3604082 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
NW339_RS17815 (3604286) | 3604286..3604765 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
NW339_RS17820 (3604933) | 3604933..3605589 | + | 657 | WP_015674862.1 | hypothetical protein | - |
NW339_RS17825 (3605586) | 3605586..3606089 | + | 504 | WP_000667000.1 | hypothetical protein | - |
NW339_RS17830 (3606127) | 3606127..3607779 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T254561 WP_000057523.1 NZ_CP102947:c3603155-3602853 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|