Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 602601..603400 | Replicon | chromosome |
Accession | NZ_CP102947 | ||
Organism | Escherichia coli strain SCAID WND1-2022 (119) |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | NW339_RS02975 | Protein ID | WP_000347251.1 |
Coordinates | 602601..603065 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | NW339_RS02980 | Protein ID | WP_001296435.1 |
Coordinates | 603065..603400 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW339_RS02945 (597602) | 597602..598036 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
NW339_RS02950 (598054) | 598054..598932 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NW339_RS02955 (598922) | 598922..599701 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NW339_RS02960 (599712) | 599712..600185 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NW339_RS02965 (600208) | 600208..601488 | - | 1281 | WP_000681950.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NW339_RS02970 (601737) | 601737..602546 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NW339_RS02975 (602601) | 602601..603065 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NW339_RS02980 (603065) | 603065..603400 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NW339_RS02985 (603549) | 603549..605120 | - | 1572 | WP_001273763.1 | galactarate dehydratase | - |
NW339_RS02990 (605495) | 605495..606829 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
NW339_RS02995 (606845) | 606845..607615 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T254550 WP_000347251.1 NZ_CP102947:c603065-602601 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PPV5 |