Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5484464..5485059 | Replicon | chromosome |
Accession | NZ_CP102946 | ||
Organism | Pseudomonas aeruginosa strain SCAID WND1-2022 (148) |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | NW341_RS25540 | Protein ID | WP_003113526.1 |
Coordinates | 5484781..5485059 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NW341_RS25535 | Protein ID | WP_003113527.1 |
Coordinates | 5484464..5484769 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW341_RS25500 (NW341_25500) | 5479604..5480452 | + | 849 | WP_003099284.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
NW341_RS25510 (NW341_25510) | 5480619..5481560 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
NW341_RS25515 (NW341_25515) | 5481677..5482291 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
NW341_RS25520 (NW341_25520) | 5482333..5482917 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
NW341_RS25525 (NW341_25525) | 5482958..5484058 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
NW341_RS25535 (NW341_25535) | 5484464..5484769 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
NW341_RS25540 (NW341_25540) | 5484781..5485059 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NW341_RS25545 (NW341_25545) | 5485112..5485240 | - | 129 | Protein_5047 | integrase | - |
NW341_RS25550 (NW341_25550) | 5485388..5487616 | + | 2229 | WP_033876905.1 | TonB-dependent receptor | - |
NW341_RS25555 (NW341_25555) | 5487686..5488333 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
NW341_RS25560 (NW341_25560) | 5488395..5489633 | - | 1239 | WP_033876906.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T254548 WP_003113526.1 NZ_CP102946:c5485059-5484781 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|