Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4766774..4767455 | Replicon | chromosome |
Accession | NZ_CP102946 | ||
Organism | Pseudomonas aeruginosa strain SCAID WND1-2022 (148) |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6AKP0 |
Locus tag | NW341_RS22155 | Protein ID | WP_003111825.1 |
Coordinates | 4767090..4767455 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1C7BMJ2 |
Locus tag | NW341_RS22150 | Protein ID | WP_003159602.1 |
Coordinates | 4766774..4767097 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW341_RS22120 (NW341_22120) | 4762231..4763109 | + | 879 | WP_003163191.1 | hypothetical protein | - |
NW341_RS22130 (NW341_22130) | 4763739..4765448 | + | 1710 | WP_003085674.1 | TIGR04141 family sporadically distributed protein | - |
NW341_RS22135 (NW341_22135) | 4765434..4766152 | - | 719 | Protein_4379 | tyrosine-type recombinase/integrase | - |
NW341_RS22140 (NW341_22140) | 4766152..4766544 | - | 393 | Protein_4380 | hypothetical protein | - |
NW341_RS22145 (NW341_22145) | 4766539..4766658 | + | 120 | Protein_4381 | IS5/IS1182 family transposase | - |
NW341_RS22150 (NW341_22150) | 4766774..4767097 | - | 324 | WP_003159602.1 | XRE family transcriptional regulator | Antitoxin |
NW341_RS22155 (NW341_22155) | 4767090..4767455 | - | 366 | WP_003111825.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NW341_RS22160 (NW341_22160) | 4767746..4767920 | - | 175 | Protein_4384 | hypothetical protein | - |
NW341_RS22165 (NW341_22165) | 4768127..4768399 | + | 273 | WP_031805311.1 | hypothetical protein | - |
NW341_RS22170 (NW341_22170) | 4768430..4768855 | - | 426 | WP_003140891.1 | VOC family protein | - |
NW341_RS22175 (NW341_22175) | 4768956..4769840 | + | 885 | WP_031805310.1 | LysR substrate-binding domain-containing protein | - |
NW341_RS22180 (NW341_22180) | 4769813..4770766 | - | 954 | WP_003085661.1 | LysR substrate-binding domain-containing protein | - |
NW341_RS22185 (NW341_22185) | 4770987..4771421 | + | 435 | WP_003116494.1 | RidA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13880.24 Da Isoelectric Point: 4.8219
>T254546 WP_003111825.1 NZ_CP102946:c4767455-4767090 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V6AKP0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1C7BMJ2 |