Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2463057..2463241 | Replicon | chromosome |
Accession | NZ_CP102945 | ||
Organism | Staphylococcus aureus strain SCAID OTT1-2022 (150) |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | NW338_RS12395 | Protein ID | WP_000482647.1 |
Coordinates | 2463134..2463241 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2463057..2463117 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW338_RS12380 | 2458587..2458754 | - | 168 | WP_001792506.1 | hypothetical protein | - |
NW338_RS12385 | 2458985..2460718 | - | 1734 | WP_000486491.1 | ABC transporter ATP-binding protein | - |
NW338_RS12390 | 2460743..2462506 | - | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein | - |
- | 2463057..2463117 | + | 61 | - | - | Antitoxin |
NW338_RS12395 | 2463134..2463241 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
NW338_RS12400 | 2463375..2463761 | - | 387 | WP_000779347.1 | flippase GtxA | - |
NW338_RS12405 | 2464019..2465161 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
NW338_RS12410 | 2465221..2465880 | + | 660 | WP_000831298.1 | membrane protein | - |
NW338_RS12415 | 2466062..2467273 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
NW338_RS12420 | 2467396..2467869 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T254540 WP_000482647.1 NZ_CP102945:c2463241-2463134 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254540 NZ_CP102945:2463057-2463117 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|