Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2182446..2182662 | Replicon | chromosome |
| Accession | NZ_CP102945 | ||
| Organism | Staphylococcus aureus strain SCAID OTT1-2022 (150) | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | NW338_RS10930 | Protein ID | WP_001802298.1 |
| Coordinates | 2182558..2182662 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2182446..2182501 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW338_RS10905 | 2178595..2179260 | - | 666 | WP_001024089.1 | SDR family oxidoreductase | - |
| NW338_RS10910 | 2179412..2179732 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| NW338_RS10915 | 2179734..2180711 | + | 978 | WP_000019733.1 | CDF family zinc efflux transporter CzrB | - |
| NW338_RS10920 | 2180977..2182068 | + | 1092 | WP_000495669.1 | hypothetical protein | - |
| - | 2182446..2182501 | + | 56 | - | - | Antitoxin |
| NW338_RS10930 | 2182558..2182662 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| NW338_RS10935 | 2183342..2183500 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| NW338_RS10940 | 2184158..2185015 | - | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
| NW338_RS10945 | 2185083..2185865 | - | 783 | WP_072498841.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T254538 WP_001802298.1 NZ_CP102945:c2182662-2182558 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT254538 NZ_CP102945:2182446-2182501 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|