Detailed information of TA system TA254533

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): txpA-SprF3/-
• Location: 1996420..1996719
• Replicon: chromosome
• Accession: NZ_CP102945
• Organism: Staphylococcus aureus strain SCAID OTT1-2022 (150)

Toxin (Protein)

• Gene name: txpA
• Uniprot ID: -
• Locus tag: NW338_RS09885
• Protein ID: WP_072353918.1
• Coordinates: 1996543..1996719 (-)
• Length: 59 a.a.

Antitoxin (RNA)

Gene name	SprF3
Locus tag	-
Coordinates	1996420..1996475 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NW338_RS09845	1991978..1992157	+	180	WP_000669791.1	hypothetical protein	-
NW338_RS09850	1992468..1992728	+	261	WP_001791826.1	hypothetical protein	-
NW338_RS09855	1992781..1993131	-	351	WP_000702263.1	complement inhibitor SCIN-A	-
NW338_RS09860	1993642..1993977	-	336	Protein_1903	SH3 domain-containing protein	-
NW338_RS09865	1994628..1995119	-	492	WP_000920038.1	staphylokinase	-
NW338_RS09870	1995310..1996065	-	756	WP_000861038.1	CHAP domain-containing protein	-
NW338_RS09875	1996077..1996331	-	255	WP_000611512.1	phage holin	-
NW338_RS09880	1996383..1996490	+	108	WP_001791821.1	hypothetical protein	-
-	1996412..1996551	+	140	NuclAT_0	-	-
-	1996412..1996551	+	140	NuclAT_0	-	-
-	1996412..1996551	+	140	NuclAT_0	-	-
-	1996412..1996551	+	140	NuclAT_0	-	-
-	1996420..1996475	+	56	-	-	Antitoxin
NW338_RS09885	1996543..1996719	-	177	WP_072353918.1	type I toxin-antitoxin system toxin PepG1	Toxin
NW338_RS09890	1996862..1997236	-	375	WP_000340977.1	hypothetical protein	-
NW338_RS09895	1997292..1997579	-	288	WP_001262620.1	hypothetical protein	-
NW338_RS09900	1997635..1997778	-	144	WP_258389925.1	hypothetical protein	-
NW338_RS09905	1997771..2001553	-	3783	WP_000582132.1	phage tail spike protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Integrative and Conjugative Element	-	hlb / groEL / hld	1995998..2074348	78350

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (30-58)

Sequences

Toxin

Protein

• Length: 59 a.a.
• Molecular weight: 6810.43 Da
• Isoelectric Point: 9.9479

>T254533 WP_072353918.1 NZ_CP102945:c1996719-1996543 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK

Nucleotide

• Length: 177 bp

Antitoxin

Nucleotide

• Length: 56 bp

>AT254533 NZ_CP102945:1996420-1996475 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG

Structures

Antitoxin