Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 1996412..1996719 | Replicon | chromosome |
| Accession | NZ_CP102945 | ||
| Organism | Staphylococcus aureus strain SCAID OTT1-2022 (150) | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | NW338_RS09885 | Protein ID | WP_072353918.1 |
| Coordinates | 1996543..1996719 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 1996412..1996551 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW338_RS09845 (1991978) | 1991978..1992157 | + | 180 | WP_000669791.1 | hypothetical protein | - |
| NW338_RS09850 (1992468) | 1992468..1992728 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| NW338_RS09855 (1992781) | 1992781..1993131 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| NW338_RS09860 (1993642) | 1993642..1993977 | - | 336 | Protein_1903 | SH3 domain-containing protein | - |
| NW338_RS09865 (1994628) | 1994628..1995119 | - | 492 | WP_000920038.1 | staphylokinase | - |
| NW338_RS09870 (1995310) | 1995310..1996065 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| NW338_RS09875 (1996077) | 1996077..1996331 | - | 255 | WP_000611512.1 | phage holin | - |
| NW338_RS09880 (1996383) | 1996383..1996490 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - (1996412) | 1996412..1996551 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1996412) | 1996412..1996551 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1996412) | 1996412..1996551 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1996412) | 1996412..1996551 | + | 140 | NuclAT_0 | - | Antitoxin |
| NW338_RS09885 (1996543) | 1996543..1996719 | - | 177 | WP_072353918.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| NW338_RS09890 (1996862) | 1996862..1997236 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| NW338_RS09895 (1997292) | 1997292..1997579 | - | 288 | WP_001262620.1 | hypothetical protein | - |
| NW338_RS09900 (1997635) | 1997635..1997778 | - | 144 | WP_258389925.1 | hypothetical protein | - |
| NW338_RS09905 (1997771) | 1997771..2001553 | - | 3783 | WP_000582132.1 | phage tail spike protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | hlb / groEL / hld | 1995998..2074348 | 78350 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T254532 WP_072353918.1 NZ_CP102945:c1996719-1996543 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT254532 NZ_CP102945:1996412-1996551 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
