Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5763167..5763762 | Replicon | chromosome |
| Accession | NZ_CP102944 | ||
| Organism | Pseudomonas aeruginosa strain SCAID TCT1-2022 (325) | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | NW342_RS27085 | Protein ID | WP_003113526.1 |
| Coordinates | 5763484..5763762 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0S3KUN4 |
| Locus tag | NW342_RS27080 | Protein ID | WP_003111575.1 |
| Coordinates | 5763167..5763472 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW342_RS27045 (NW342_27045) | 5758307..5759155 | + | 849 | WP_031686602.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| NW342_RS27055 (NW342_27055) | 5759322..5760263 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| NW342_RS27060 (NW342_27060) | 5760380..5760994 | + | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| NW342_RS27065 (NW342_27065) | 5761036..5761620 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| NW342_RS27070 (NW342_27070) | 5761661..5762761 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| NW342_RS27080 (NW342_27080) | 5763167..5763472 | - | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
| NW342_RS27085 (NW342_27085) | 5763484..5763762 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NW342_RS27090 (NW342_27090) | 5763815..5763943 | - | 129 | Protein_5355 | integrase | - |
| NW342_RS27095 (NW342_27095) | 5764091..5766319 | + | 2229 | WP_033991161.1 | TonB-dependent receptor | - |
| NW342_RS27100 (NW342_27100) | 5766390..5767037 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| NW342_RS27105 (NW342_27105) | 5767099..5768337 | - | 1239 | WP_031686604.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T254529 WP_003113526.1 NZ_CP102944:c5763762-5763484 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V6ALY3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3KUN4 |