Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 150528..151255 Replicon plasmid unnamed
Accession NZ_CP102941
Organism Klebsiella pneumoniae strain SCAID PND1-2022 (426)

Toxin (Protein)


Gene name higB Uniprot ID A0A5Q9LNL2
Locus tag NW340_RS26765 Protein ID WP_004118600.1
Coordinates 150944..151255 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID V0AHC4
Locus tag NW340_RS26760 Protein ID WP_000990392.1
Coordinates 150528..150947 (-) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW340_RS26725 (NW340_26725) 146215..146577 - 363 WP_020324593.1 arsenite efflux transporter metallochaperone ArsD -
NW340_RS26730 (NW340_26730) 146625..146978 - 354 WP_001114073.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
NW340_RS26735 (NW340_26735) 147271..147411 + 141 WP_004118614.1 hypothetical protein -
NW340_RS26740 (NW340_26740) 147531..147887 + 357 WP_077253206.1 Ref family recombination enhancement nuclease -
NW340_RS26745 (NW340_26745) 148311..148970 + 660 WP_000078540.1 hypothetical protein -
NW340_RS26750 (NW340_26750) 148967..149296 + 330 WP_004118613.1 hypothetical protein -
NW340_RS26755 (NW340_26755) 149289..150491 + 1203 WP_003031541.1 hypothetical protein -
NW340_RS26760 (NW340_26760) 150528..150947 - 420 WP_000990392.1 helix-turn-helix domain-containing protein Antitoxin
NW340_RS26765 (NW340_26765) 150944..151255 - 312 WP_004118600.1 type II toxin-antitoxin system HigB family toxin Toxin
NW340_RS26770 (NW340_26770) 151466..151846 + 381 Protein_180 gluconate permease -
NW340_RS26775 (NW340_26775) 151896..152591 - 696 WP_004118595.1 lactate utilization protein C -
NW340_RS26780 (NW340_26780) 152584..154011 - 1428 WP_000023895.1 LutB/LldF family L-lactate oxidation iron-sulfur protein -
NW340_RS26785 (NW340_26785) 154022..154741 - 720 WP_001102107.1 (Fe-S)-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / dfrA1 / qacE / sul1 / qnrS1 / blaLAP-2 / blaCTX-M-14 - 1..224137 224137


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(20-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(83-136)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12386.14 Da        Isoelectric Point: 10.0935

>T254519 WP_004118600.1 NZ_CP102941:c151255-150944 [Klebsiella pneumoniae]
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE

Download         Length: 312 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15534.71 Da        Isoelectric Point: 4.4702

>AT254519 WP_000990392.1 NZ_CP102941:c150947-150528 [Klebsiella pneumoniae]
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LNL2

Antitoxin

Source ID Structure
AlphaFold DB V0AHC4

References