Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 2447..3032 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP102937 | ||
| Organism | Acinetobacter sp. AOR07_HL | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | N8ZPD7 |
| Locus tag | MKL45_RS19340 | Protein ID | WP_000897309.1 |
| Coordinates | 2447..2767 (+) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | MKL45_RS19345 | Protein ID | WP_000369780.1 |
| Coordinates | 2760..3032 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MKL45_RS19315 (MKL45_19320) | 126..392 | + | 267 | WP_188200041.1 | mobilization protein | - |
| MKL45_RS19320 (MKL45_19325) | 410..1129 | + | 720 | WP_001218546.1 | hypothetical protein | - |
| MKL45_RS19325 (MKL45_19330) | 1455..1670 | + | 216 | WP_000071892.1 | cold-shock protein | - |
| MKL45_RS19330 (MKL45_19335) | 1769..1996 | + | 228 | WP_000921865.1 | hypothetical protein | - |
| MKL45_RS19335 (MKL45_19340) | 2063..2260 | + | 198 | WP_000476222.1 | hypothetical protein | - |
| MKL45_RS19340 (MKL45_19345) | 2447..2767 | + | 321 | WP_000897309.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| MKL45_RS19345 (MKL45_19350) | 2760..3032 | + | 273 | WP_000369780.1 | NadS family protein | Antitoxin |
| MKL45_RS19350 (MKL45_19355) | 3650..4168 | + | 519 | WP_000447193.1 | tetratricopeptide repeat protein | - |
| MKL45_RS19355 (MKL45_19360) | 4356..4583 | - | 228 | WP_004812234.1 | hypothetical protein | - |
| MKL45_RS19360 (MKL45_19365) | 4971..5495 | - | 525 | WP_034684955.1 | plasmid replication DNA-binding protein | - |
| MKL45_RS19365 (MKL45_19370) | 5574..6503 | - | 930 | WP_034684953.1 | replication initiation protein RepM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..8571 | 8571 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12209.01 Da Isoelectric Point: 7.9835
>T254506 WP_000897309.1 NZ_CP102937:2447-2767 [Acinetobacter sp. AOR07_HL]
MLFIETSIFTKQIKELVSDEEYRQLQQDLLVQPDKGDLIKNGGGIRKVRCAQGNKGKSGGIRVIYYWVTEDDQIFFLVAY
PKSVKDNLTDKETSILRQLVKEQFHG
MLFIETSIFTKQIKELVSDEEYRQLQQDLLVQPDKGDLIKNGGGIRKVRCAQGNKGKSGGIRVIYYWVTEDDQIFFLVAY
PKSVKDNLTDKETSILRQLVKEQFHG
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|