Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2957733..2958393 | Replicon | chromosome |
Accession | NZ_CP102932 | ||
Organism | Enterobacter sp. Crenshaw |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A808IFD9 |
Locus tag | NWV12_RS14195 | Protein ID | WP_048980127.1 |
Coordinates | 2958040..2958393 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1Z3MX79 |
Locus tag | NWV12_RS14190 | Protein ID | WP_029741460.1 |
Coordinates | 2957733..2958035 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWV12_RS14170 (NWV12_14170) | 2953710..2955899 | + | 2190 | WP_045356712.1 | TonB-dependent siderophore receptor | - |
NWV12_RS14180 (NWV12_14180) | 2956194..2956595 | - | 402 | WP_048980122.1 | RidA family protein | - |
NWV12_RS14185 (NWV12_14185) | 2956737..2957657 | + | 921 | WP_048980124.1 | LysR family transcriptional regulator | - |
NWV12_RS14190 (NWV12_14190) | 2957733..2958035 | - | 303 | WP_029741460.1 | XRE family transcriptional regulator | Antitoxin |
NWV12_RS14195 (NWV12_14195) | 2958040..2958393 | - | 354 | WP_048980127.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NWV12_RS14200 (NWV12_14200) | 2958571..2959464 | - | 894 | WP_048980130.1 | LysR substrate-binding domain-containing protein | - |
NWV12_RS14205 (NWV12_14205) | 2959638..2960243 | + | 606 | WP_048980132.1 | glutathione S-transferase family protein | - |
NWV12_RS14210 (NWV12_14210) | 2960287..2961237 | - | 951 | WP_023336219.1 | HTH-type transcriptional regulator Cbl | - |
NWV12_RS14215 (NWV12_14215) | 2961334..2962251 | - | 918 | WP_033145933.1 | nitrogen assimilation transcriptional regulator NAC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13599.44 Da Isoelectric Point: 8.9620
>T254495 WP_048980127.1 NZ_CP102932:c2958393-2958040 [Enterobacter sp. Crenshaw]
VWAINTTDRFDRWFTSLDDTDRASVLAALLVLREKGPGLSRPYADTLKGSRYSNMKELRIQSKGDPLRAFFAFDPNRTGI
VLCAGNKVGNERRFYDEMLLVADREFTHWLDRLKERE
VWAINTTDRFDRWFTSLDDTDRASVLAALLVLREKGPGLSRPYADTLKGSRYSNMKELRIQSKGDPLRAFFAFDPNRTGI
VLCAGNKVGNERRFYDEMLLVADREFTHWLDRLKERE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A808IFD9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Z3MX79 |