Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 100143..100870 | Replicon | plasmid pK18-45_P1 |
| Accession | NZ_CP102922 | ||
| Organism | Klebsiella quasipneumoniae strain K18-45 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | NWF33_RS25840 | Protein ID | WP_011251285.1 |
| Coordinates | 100559..100870 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NWF33_RS25835 | Protein ID | WP_011251286.1 |
| Coordinates | 100143..100562 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWF33_RS25810 (NWF33_25810) | 95216..96583 | + | 1368 | WP_017900870.1 | formimidoylglutamate deiminase | - |
| NWF33_RS25815 (NWF33_25815) | 97134..98114 | + | 981 | WP_012569499.1 | IS5-like element ISKpn26 family transposase | - |
| NWF33_RS25820 (NWF33_25820) | 98277..98543 | - | 267 | WP_017900868.1 | hypothetical protein | - |
| NWF33_RS25825 (NWF33_25825) | 98647..99614 | + | 968 | Protein_104 | IS5 family transposase | - |
| NWF33_RS25830 (NWF33_25830) | 99660..100073 | - | 414 | WP_017901337.1 | hypothetical protein | - |
| NWF33_RS25835 (NWF33_25835) | 100143..100562 | - | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NWF33_RS25840 (NWF33_25840) | 100559..100870 | - | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NWF33_RS25845 (NWF33_25845) | 101075..101512 | - | 438 | Protein_108 | DDE-type integrase/transposase/recombinase | - |
| NWF33_RS25850 (NWF33_25850) | 101626..102003 | + | 378 | WP_004118218.1 | transposase | - |
| NWF33_RS25855 (NWF33_25855) | 102000..102347 | + | 348 | WP_032430752.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NWF33_RS25860 (NWF33_25860) | 102396..103934 | + | 1539 | WP_017901237.1 | IS66 family transposase | - |
| NWF33_RS25865 (NWF33_25865) | 103974..104153 | + | 180 | Protein_112 | IS5/IS1182 family transposase | - |
| NWF33_RS25870 (NWF33_25870) | 104216..105138 | + | 923 | Protein_113 | IS5 family transposase | - |
| NWF33_RS25875 (NWF33_25875) | 105194..105454 | + | 261 | Protein_114 | integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | pla | 1..220751 | 220751 | |
| - | inside | IScluster/Tn | - | - | 97134..111001 | 13867 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T254460 WP_011251285.1 NZ_CP102922:c100870-100559 [Klebsiella quasipneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT254460 WP_011251286.1 NZ_CP102922:c100562-100143 [Klebsiella quasipneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|