Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3833778..3834375 | Replicon | chromosome |
Accession | NZ_CP102921 | ||
Organism | Klebsiella quasipneumoniae strain K18-45 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A3T0QUS6 |
Locus tag | NWF33_RS18875 | Protein ID | WP_017899012.1 |
Coordinates | 3834058..3834375 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A3T0QUV3 |
Locus tag | NWF33_RS18870 | Protein ID | WP_017899013.1 |
Coordinates | 3833778..3834065 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWF33_RS18840 (3829865) | 3829865..3830113 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
NWF33_RS18845 (3830131) | 3830131..3830472 | - | 342 | WP_004202492.1 | RamA family antibiotic efflux transcriptional regulator | - |
NWF33_RS18850 (3830503) | 3830503..3831618 | - | 1116 | WP_025999133.1 | MBL fold metallo-hydrolase | - |
NWF33_RS18855 (3831798) | 3831798..3832379 | + | 582 | WP_017899014.1 | TetR/AcrR family transcriptional regulator | - |
NWF33_RS18860 (3832379) | 3832379..3832747 | + | 369 | WP_004202487.1 | MmcQ/YjbR family DNA-binding protein | - |
NWF33_RS18865 (3832867) | 3832867..3833520 | + | 654 | WP_004202485.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
NWF33_RS18870 (3833778) | 3833778..3834065 | - | 288 | WP_017899013.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NWF33_RS18875 (3834058) | 3834058..3834375 | - | 318 | WP_017899012.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NWF33_RS18880 (3834560) | 3834560..3835603 | - | 1044 | WP_017899011.1 | hypothetical protein | - |
NWF33_RS18885 (3836136) | 3836136..3837005 | - | 870 | WP_017900842.1 | helix-turn-helix transcriptional regulator | - |
NWF33_RS18890 (3837114) | 3837114..3838541 | + | 1428 | WP_017900841.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12185.52 Da Isoelectric Point: 11.2767
>T254456 WP_017899012.1 NZ_CP102921:c3834375-3834058 [Klebsiella quasipneumoniae]
MFRMVVHVDVKKELQALPAIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQNKTLFLLRVF
VKKTQKTPLSEIRLALKRLEEMRNE
MFRMVVHVDVKKELQALPAIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQNKTLFLLRVF
VKKTQKTPLSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3T0QUS6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3T0QUV3 |