Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3878487..3879084 | Replicon | chromosome |
Accession | NZ_CP102898 | ||
Organism | Klebsiella quasipneumoniae strain KW1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NWT83_RS19040 | Protein ID | WP_049013659.1 |
Coordinates | 3878767..3879084 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NWT83_RS19035 | Protein ID | WP_049013658.1 |
Coordinates | 3878487..3878774 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWT83_RS19005 (3874675) | 3874675..3874923 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
NWT83_RS19010 (3874941) | 3874941..3875282 | - | 342 | WP_004202492.1 | RamA family antibiotic efflux transcriptional regulator | - |
NWT83_RS19015 (3875313) | 3875313..3876428 | - | 1116 | WP_074442613.1 | MBL fold metallo-hydrolase | - |
NWT83_RS19020 (3876608) | 3876608..3877192 | + | 585 | WP_023288732.1 | TetR/AcrR family transcriptional regulator | - |
NWT83_RS19025 (3877189) | 3877189..3877557 | + | 369 | WP_004202487.1 | MmcQ/YjbR family DNA-binding protein | - |
NWT83_RS19030 (3877677) | 3877677..3878330 | + | 654 | WP_023288731.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
NWT83_RS19035 (3878487) | 3878487..3878774 | - | 288 | WP_049013658.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NWT83_RS19040 (3878767) | 3878767..3879084 | - | 318 | WP_049013659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NWT83_RS19045 (3879269) | 3879269..3880312 | - | 1044 | WP_065882587.1 | DUF2157 domain-containing protein | - |
NWT83_RS19050 (3880828) | 3880828..3881694 | - | 867 | WP_023288725.1 | helix-turn-helix transcriptional regulator | - |
NWT83_RS19055 (3881803) | 3881803..3883230 | + | 1428 | WP_048296961.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12102.38 Da Isoelectric Point: 11.2767
>T254437 WP_049013659.1 NZ_CP102898:c3879084-3878767 [Klebsiella quasipneumoniae]
MFRMVVHVDVKKELQALPAIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRMVVHVDVKKELQALPAIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|