Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 348106..348752 | Replicon | chromosome |
| Accession | NZ_CP102891 | ||
| Organism | Klebsiella pneumoniae strain KW3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NWT73_RS01610 | Protein ID | WP_023288046.1 |
| Coordinates | 348106..348453 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | W8UB68 |
| Locus tag | NWT73_RS01615 | Protein ID | WP_002920557.1 |
| Coordinates | 348453..348752 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWT73_RS01600 (NWT73_01600) | 344032..345465 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
| NWT73_RS01605 (NWT73_01605) | 345483..347930 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
| NWT73_RS01610 (NWT73_01610) | 348106..348453 | + | 348 | WP_023288046.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NWT73_RS01615 (NWT73_01615) | 348453..348752 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NWT73_RS01620 (NWT73_01620) | 348815..350323 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
| NWT73_RS01625 (NWT73_01625) | 350528..350857 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| NWT73_RS01630 (NWT73_01630) | 350908..351738 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| NWT73_RS01635 (NWT73_01635) | 351788..352546 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13518.59 Da Isoelectric Point: 6.7210
>T254404 WP_023288046.1 NZ_CP102891:348106-348453 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKGSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCVGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKGSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCVGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|