Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 321918..322504 Replicon chromosome
Accession NZ_CP102889
Organism Klebsiella pneumoniae strain KW2

Toxin (Protein)


Gene name doc Uniprot ID A0A331ME34
Locus tag NWT79_RS01500 Protein ID WP_025861226.1
Coordinates 322136..322504 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NWT79_RS01495 Protein ID WP_004174006.1
Coordinates 321918..322139 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWT79_RS01475 (NWT79_01475) 318075..319001 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NWT79_RS01480 (NWT79_01480) 318998..320275 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NWT79_RS01485 (NWT79_01485) 320272..321039 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NWT79_RS01490 (NWT79_01490) 321041..321754 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NWT79_RS01495 (NWT79_01495) 321918..322139 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NWT79_RS01500 (NWT79_01500) 322136..322504 + 369 WP_025861226.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NWT79_RS01505 (NWT79_01505) 322777..324093 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NWT79_RS01510 (NWT79_01510) 324200..325087 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NWT79_RS01515 (NWT79_01515) 325084..325929 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NWT79_RS01520 (NWT79_01520) 325931..327001 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 318998..327738 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13551.98 Da        Isoelectric Point: 8.6410

>T254390 WP_025861226.1 NZ_CP102889:322136-322504 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGIKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT254390 WP_004174006.1 NZ_CP102889:321918-322139 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A331ME34

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References