Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 730641..731416 | Replicon | chromosome |
| Accession | NZ_CP102883 | ||
| Organism | Klebsiella pneumoniae strain KH2 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
| Locus tag | M2890_RS03615 | Protein ID | WP_004150910.1 |
| Coordinates | 730931..731416 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | W8UEW1 |
| Locus tag | M2890_RS03610 | Protein ID | WP_004150912.1 |
| Coordinates | 730641..730934 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2890_RS03590 (725849) | 725849..726451 | - | 603 | WP_002916735.1 | short chain dehydrogenase | - |
| M2890_RS03595 (726549) | 726549..727460 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
| M2890_RS03600 (727461) | 727461..728609 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
| M2890_RS03605 (728620) | 728620..729996 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
| M2890_RS03610 (730641) | 730641..730934 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
| M2890_RS03615 (730931) | 730931..731416 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
| M2890_RS03620 (732120) | 732120..732713 | + | 594 | WP_004188553.1 | hypothetical protein | - |
| M2890_RS03625 (732810) | 732810..733026 | + | 217 | Protein_712 | transposase | - |
| M2890_RS03630 (733632) | 733632..734504 | + | 873 | WP_004188557.1 | ParA family protein | - |
| M2890_RS03635 (734504) | 734504..734887 | + | 384 | WP_004150906.1 | hypothetical protein | - |
| M2890_RS03640 (734880) | 734880..736247 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 732810..732962 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T254371 WP_004150910.1 NZ_CP102883:730931-731416 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q4Q548 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GVL4 |