Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 351963..352609 | Replicon | chromosome |
Accession | NZ_CP102877 | ||
Organism | Klebsiella pneumoniae strain KH1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A483JFR4 |
Locus tag | NWT87_RS01620 | Protein ID | WP_004188313.1 |
Coordinates | 351963..352310 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A483GM64 |
Locus tag | NWT87_RS01625 | Protein ID | WP_004188315.1 |
Coordinates | 352310..352609 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWT87_RS01610 (347889) | 347889..349322 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
NWT87_RS01615 (349340) | 349340..351787 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
NWT87_RS01620 (351963) | 351963..352310 | + | 348 | WP_004188313.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NWT87_RS01625 (352310) | 352310..352609 | + | 300 | WP_004188315.1 | XRE family transcriptional regulator | Antitoxin |
NWT87_RS01630 (352672) | 352672..354180 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
NWT87_RS01635 (354385) | 354385..354714 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
NWT87_RS01640 (354765) | 354765..355595 | + | 831 | WP_004188317.1 | rhomboid family intramembrane serine protease GlpG | - |
NWT87_RS01645 (355645) | 355645..356403 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13548.57 Da Isoelectric Point: 6.2327
>T254349 WP_004188313.1 NZ_CP102877:351963-352310 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483JFR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483GM64 |