Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 325776..326362 | Replicon | chromosome |
Accession | NZ_CP102877 | ||
Organism | Klebsiella pneumoniae strain KH1 |
Toxin (Protein)
Gene name | doc | Uniprot ID | W8VD46 |
Locus tag | NWT87_RS01510 | Protein ID | WP_002920800.1 |
Coordinates | 325994..326362 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A483YZZ9 |
Locus tag | NWT87_RS01505 | Protein ID | WP_019725146.1 |
Coordinates | 325776..325997 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWT87_RS01485 (321933) | 321933..322859 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
NWT87_RS01490 (322856) | 322856..324133 | + | 1278 | WP_004188292.1 | branched chain amino acid ABC transporter permease LivM | - |
NWT87_RS01495 (324130) | 324130..324897 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
NWT87_RS01500 (324899) | 324899..325612 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
NWT87_RS01505 (325776) | 325776..325997 | + | 222 | WP_019725146.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NWT87_RS01510 (325994) | 325994..326362 | + | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NWT87_RS01515 (326635) | 326635..327951 | + | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
NWT87_RS01520 (328058) | 328058..328945 | + | 888 | WP_014906831.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
NWT87_RS01525 (328942) | 328942..329787 | + | 846 | WP_004145129.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
NWT87_RS01530 (329789) | 329789..330859 | + | 1071 | WP_004188298.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 310513..331596 | 21083 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T254348 WP_002920800.1 NZ_CP102877:325994-326362 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GUD1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483YZZ9 |