254348

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 325776..326362 Replicon chromosome
Accession NZ_CP102877
Organism Klebsiella pneumoniae strain KH1

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NWT87_RS01510 Protein ID WP_002920800.1
Coordinates 325994..326362 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A483YZZ9
Locus tag NWT87_RS01505 Protein ID WP_019725146.1
Coordinates 325776..325997 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWT87_RS01485 (321933) 321933..322859 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NWT87_RS01490 (322856) 322856..324133 + 1278 WP_004188292.1 branched chain amino acid ABC transporter permease LivM -
NWT87_RS01495 (324130) 324130..324897 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NWT87_RS01500 (324899) 324899..325612 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NWT87_RS01505 (325776) 325776..325997 + 222 WP_019725146.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NWT87_RS01510 (325994) 325994..326362 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NWT87_RS01515 (326635) 326635..327951 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NWT87_RS01520 (328058) 328058..328945 + 888 WP_014906831.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NWT87_RS01525 (328942) 328942..329787 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NWT87_RS01530 (329789) 329789..330859 + 1071 WP_004188298.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 310513..331596 21083


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T254348 WP_002920800.1 NZ_CP102877:325994-326362 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT254348 WP_019725146.1 NZ_CP102877:325776-325997 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A483YZZ9

References