Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 722296..723071 | Replicon | chromosome |
Accession | NZ_CP102869 | ||
Organism | Klebsiella pneumoniae strain KA2 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | NWT85_RS03580 | Protein ID | WP_004150910.1 |
Coordinates | 722586..723071 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | NWT85_RS03575 | Protein ID | WP_004150912.1 |
Coordinates | 722296..722589 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWT85_RS03555 (NWT85_03555) | 717504..718106 | - | 603 | WP_002916735.1 | short chain dehydrogenase | - |
NWT85_RS03560 (NWT85_03560) | 718204..719115 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
NWT85_RS03565 (NWT85_03565) | 719116..720264 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
NWT85_RS03570 (NWT85_03570) | 720275..721651 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
NWT85_RS03575 (NWT85_03575) | 722296..722589 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
NWT85_RS03580 (NWT85_03580) | 722586..723071 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
NWT85_RS03585 (NWT85_03585) | 723775..724368 | + | 594 | WP_004188553.1 | hypothetical protein | - |
NWT85_RS03590 (NWT85_03590) | 724465..724681 | + | 217 | Protein_704 | transposase | - |
NWT85_RS03595 (NWT85_03595) | 725287..726159 | + | 873 | WP_004188557.1 | ParA family protein | - |
NWT85_RS03600 (NWT85_03600) | 726159..726542 | + | 384 | WP_004150906.1 | hypothetical protein | - |
NWT85_RS03605 (NWT85_03605) | 726535..727902 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 724465..724617 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T254330 WP_004150910.1 NZ_CP102869:722586-723071 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |