Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 325878..326464 Replicon chromosome
Accession NZ_CP102869
Organism Klebsiella pneumoniae strain KA2

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NWT85_RS01515 Protein ID WP_002920800.1
Coordinates 326096..326464 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NWT85_RS01510 Protein ID WP_004174006.1
Coordinates 325878..326099 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWT85_RS01490 (NWT85_01490) 322035..322961 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NWT85_RS01495 (NWT85_01495) 322958..324235 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NWT85_RS01500 (NWT85_01500) 324232..324999 + 768 WP_032435160.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NWT85_RS01505 (NWT85_01505) 325001..325714 + 714 WP_087652577.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NWT85_RS01510 (NWT85_01510) 325878..326099 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NWT85_RS01515 (NWT85_01515) 326096..326464 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NWT85_RS01520 (NWT85_01520) 326737..328053 + 1317 WP_032435158.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NWT85_RS01525 (NWT85_01525) 328160..329047 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NWT85_RS01530 (NWT85_01530) 329044..329889 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NWT85_RS01535 (NWT85_01535) 329891..330961 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 322958..331698 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T254328 WP_002920800.1 NZ_CP102869:326096-326464 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT254328 WP_004174006.1 NZ_CP102869:325878-326099 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References