Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 325878..326464 | Replicon | chromosome |
| Accession | NZ_CP102869 | ||
| Organism | Klebsiella pneumoniae strain KA2 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | W8VD46 |
| Locus tag | NWT85_RS01515 | Protein ID | WP_002920800.1 |
| Coordinates | 326096..326464 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | W9B1V1 |
| Locus tag | NWT85_RS01510 | Protein ID | WP_004174006.1 |
| Coordinates | 325878..326099 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWT85_RS01490 (NWT85_01490) | 322035..322961 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NWT85_RS01495 (NWT85_01495) | 322958..324235 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
| NWT85_RS01500 (NWT85_01500) | 324232..324999 | + | 768 | WP_032435160.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| NWT85_RS01505 (NWT85_01505) | 325001..325714 | + | 714 | WP_087652577.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| NWT85_RS01510 (NWT85_01510) | 325878..326099 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NWT85_RS01515 (NWT85_01515) | 326096..326464 | + | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NWT85_RS01520 (NWT85_01520) | 326737..328053 | + | 1317 | WP_032435158.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| NWT85_RS01525 (NWT85_01525) | 328160..329047 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| NWT85_RS01530 (NWT85_01530) | 329044..329889 | + | 846 | WP_004185988.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| NWT85_RS01535 (NWT85_01535) | 329891..330961 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 322958..331698 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T254328 WP_002920800.1 NZ_CP102869:326096-326464 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GUD1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E5YJY7 |