Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 122814..123047 | Replicon | plasmid p573-2 |
| Accession | NZ_CP102855 | ||
| Organism | Escherichia coli strain 573 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | NWH85_RS24765 | Protein ID | WP_001372321.1 |
| Coordinates | 122814..122939 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 123016..123047 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWH85_RS24725 (118188) | 118188..118877 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| NWH85_RS24730 (119064) | 119064..119447 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| NWH85_RS24735 (119768) | 119768..120370 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| NWH85_RS24740 (120667) | 120667..121488 | - | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| NWH85_RS24745 (121606) | 121606..121893 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| NWH85_RS24750 (121918) | 121918..122124 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| NWH85_RS24755 (122194) | 122194..122366 | + | 173 | Protein_133 | hypothetical protein | - |
| NWH85_RS24760 (122364) | 122364..122594 | - | 231 | WP_071586998.1 | hypothetical protein | - |
| NWH85_RS24765 (122814) | 122814..122939 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| NWH85_RS24770 (122881) | 122881..123030 | - | 150 | Protein_136 | plasmid maintenance protein Mok | - |
| - (123016) | 123016..123047 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (123016) | 123016..123047 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (123016) | 123016..123047 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (123016) | 123016..123047 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (124489) | 124489..124686 | - | 198 | NuclAT_0 | - | - |
| - (124489) | 124489..124686 | - | 198 | NuclAT_0 | - | - |
| - (124489) | 124489..124686 | - | 198 | NuclAT_0 | - | - |
| - (124489) | 124489..124686 | - | 198 | NuclAT_0 | - | - |
| NWH85_RS24780 (124498) | 124498..124686 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| NWH85_RS24785 (124655) | 124655..125417 | - | 763 | Protein_139 | plasmid SOS inhibition protein A | - |
| NWH85_RS24790 (125414) | 125414..125848 | - | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
| NWH85_RS24795 (125903) | 125903..126100 | - | 198 | Protein_141 | hypothetical protein | - |
| NWH85_RS24800 (126128) | 126128..126361 | - | 234 | WP_000005987.1 | DUF905 family protein | - |
| NWH85_RS24805 (126429) | 126429..126968 | - | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| NWH85_RS24810 (126994) | 126994..127200 | - | 207 | WP_000275856.1 | hypothetical protein | - |
| NWH85_RS24815 (127270) | 127270..127350 | + | 81 | Protein_145 | hypothetical protein | - |
| NWH85_RS24820 (127533) | 127533..127702 | - | 170 | Protein_146 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / blaCTX-M-14 / fosA3 / aac(3)-IVa / sul2 / floR / blaTEM-1B / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..149702 | 149702 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T254313 WP_001372321.1 NZ_CP102855:c122939-122814 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 32 bp
>AT254313 NZ_CP102855:c123047-123016 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|