Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 122814..123047 Replicon plasmid p573-2
Accession NZ_CP102855
Organism Escherichia coli strain 573

Toxin (Protein)


Gene name hok Uniprot ID -
Locus tag NWH85_RS24765 Protein ID WP_001372321.1
Coordinates 122814..122939 (-) Length 42 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 123016..123047 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWH85_RS24725 (118188) 118188..118877 - 690 WP_000283385.1 conjugal transfer transcriptional regulator TraJ -
NWH85_RS24730 (119064) 119064..119447 - 384 WP_001151524.1 conjugal transfer relaxosome DNA-binding protein TraM -
NWH85_RS24735 (119768) 119768..120370 + 603 WP_000243712.1 transglycosylase SLT domain-containing protein -
NWH85_RS24740 (120667) 120667..121488 - 822 WP_001234426.1 DUF932 domain-containing protein -
NWH85_RS24745 (121606) 121606..121893 - 288 WP_000107535.1 hypothetical protein -
NWH85_RS24750 (121918) 121918..122124 - 207 WP_000547968.1 hypothetical protein -
NWH85_RS24755 (122194) 122194..122366 + 173 Protein_133 hypothetical protein -
NWH85_RS24760 (122364) 122364..122594 - 231 WP_071586998.1 hypothetical protein -
NWH85_RS24765 (122814) 122814..122939 - 126 WP_001372321.1 type I toxin-antitoxin system Hok family toxin Toxin
NWH85_RS24770 (122881) 122881..123030 - 150 Protein_136 plasmid maintenance protein Mok -
- (123016) 123016..123047 - 32 NuclAT_1 - Antitoxin
- (123016) 123016..123047 - 32 NuclAT_1 - Antitoxin
- (123016) 123016..123047 - 32 NuclAT_1 - Antitoxin
- (123016) 123016..123047 - 32 NuclAT_1 - Antitoxin
- (124489) 124489..124686 - 198 NuclAT_0 - -
- (124489) 124489..124686 - 198 NuclAT_0 - -
- (124489) 124489..124686 - 198 NuclAT_0 - -
- (124489) 124489..124686 - 198 NuclAT_0 - -
NWH85_RS24780 (124498) 124498..124686 + 189 WP_001299721.1 hypothetical protein -
NWH85_RS24785 (124655) 124655..125417 - 763 Protein_139 plasmid SOS inhibition protein A -
NWH85_RS24790 (125414) 125414..125848 - 435 WP_000845936.1 conjugation system SOS inhibitor PsiB -
NWH85_RS24795 (125903) 125903..126100 - 198 Protein_141 hypothetical protein -
NWH85_RS24800 (126128) 126128..126361 - 234 WP_000005987.1 DUF905 family protein -
NWH85_RS24805 (126429) 126429..126968 - 540 WP_000290840.1 single-stranded DNA-binding protein -
NWH85_RS24810 (126994) 126994..127200 - 207 WP_000275856.1 hypothetical protein -
NWH85_RS24815 (127270) 127270..127350 + 81 Protein_145 hypothetical protein -
NWH85_RS24820 (127533) 127533..127702 - 170 Protein_146 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / blaCTX-M-14 / fosA3 / aac(3)-IVa / sul2 / floR / blaTEM-1B / sitABCD iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..149702 149702


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(2-37)


Sequences

Toxin        


Download         Length: 42 a.a.        Molecular weight: 4780.69 Da        Isoelectric Point: 8.5110

>T254313 WP_001372321.1 NZ_CP102855:c122939-122814 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Download         Length: 126 bp

Antitoxin


Download         Length: 32 bp

>AT254313 NZ_CP102855:c123047-123016 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References