Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 84485..84739 | Replicon | plasmid p573-2 |
| Accession | NZ_CP102855 | ||
| Organism | Escherichia coli strain 573 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NWH85_RS24530 | Protein ID | WP_001312851.1 |
| Coordinates | 84485..84634 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 84678..84739 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWH85_RS24485 (80048) | 80048..80449 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NWH85_RS24490 (80382) | 80382..80639 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NWH85_RS24495 (80732) | 80732..81040 | - | 309 | WP_226116723.1 | CPBP family intramembrane metalloprotease | - |
| NWH85_RS24500 (80982) | 80982..81374 | - | 393 | WP_000616804.1 | histidine phosphatase family protein | - |
| NWH85_RS24505 (82313) | 82313..83170 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| NWH85_RS24510 (83163) | 83163..83645 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| NWH85_RS24515 (83638) | 83638..83685 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| NWH85_RS24520 (83676) | 83676..83927 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| NWH85_RS24525 (83944) | 83944..84201 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| NWH85_RS24530 (84485) | 84485..84634 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (84678) | 84678..84739 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (84678) | 84678..84739 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (84678) | 84678..84739 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (84678) | 84678..84739 | + | 62 | NuclAT_2 | - | Antitoxin |
| NWH85_RS24535 (84995) | 84995..85069 | - | 75 | Protein_89 | endonuclease | - |
| NWH85_RS24540 (85315) | 85315..85527 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| NWH85_RS24545 (85663) | 85663..86223 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| NWH85_RS24550 (86326) | 86326..87186 | - | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
| NWH85_RS24555 (87245) | 87245..87991 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / blaCTX-M-14 / fosA3 / aac(3)-IVa / sul2 / floR / blaTEM-1B / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..149702 | 149702 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T254308 WP_001312851.1 NZ_CP102855:c84634-84485 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT254308 NZ_CP102855:84678-84739 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
