Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4499940..4500542 | Replicon | chromosome |
| Accession | NZ_CP102853 | ||
| Organism | Escherichia coli strain 573 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | NWH85_RS21830 | Protein ID | WP_000897305.1 |
| Coordinates | 4500231..4500542 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NWH85_RS21825 | Protein ID | WP_000356397.1 |
| Coordinates | 4499940..4500230 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWH85_RS21800 (4495865) | 4495865..4496767 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| NWH85_RS21805 (4496764) | 4496764..4497399 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NWH85_RS21810 (4497396) | 4497396..4498325 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| NWH85_RS21815 (4498655) | 4498655..4498897 | - | 243 | WP_001087409.1 | protein YiiF | - |
| NWH85_RS21820 (4499117) | 4499117..4499335 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
| NWH85_RS21825 (4499940) | 4499940..4500230 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| NWH85_RS21830 (4500231) | 4500231..4500542 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| NWH85_RS21835 (4500771) | 4500771..4501679 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| NWH85_RS21840 (4501743) | 4501743..4502684 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NWH85_RS21845 (4502729) | 4502729..4503166 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| NWH85_RS21850 (4503163) | 4503163..4504035 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| NWH85_RS21855 (4504029) | 4504029..4504628 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| NWH85_RS21860 (4504727) | 4504727..4505512 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T254306 WP_000897305.1 NZ_CP102853:c4500542-4500231 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|