Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 593394..594193 | Replicon | chromosome |
Accession | NZ_CP102853 | ||
Organism | Escherichia coli strain 573 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | F4VJD3 |
Locus tag | NWH85_RS02895 | Protein ID | WP_000347266.1 |
Coordinates | 593394..593858 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | NWH85_RS02900 | Protein ID | WP_001307405.1 |
Coordinates | 593858..594193 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWH85_RS02865 (588395) | 588395..588829 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
NWH85_RS02870 (588847) | 588847..589725 | - | 879 | WP_001315856.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NWH85_RS02875 (589715) | 589715..590494 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NWH85_RS02880 (590505) | 590505..590978 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NWH85_RS02885 (591001) | 591001..592281 | - | 1281 | WP_258334515.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NWH85_RS02890 (592530) | 592530..593339 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NWH85_RS02895 (593394) | 593394..593858 | - | 465 | WP_000347266.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NWH85_RS02900 (593858) | 593858..594193 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NWH85_RS02905 (594342) | 594342..595913 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
NWH85_RS02910 (596288) | 596288..597622 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
NWH85_RS02915 (597638) | 597638..598408 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 593394..605068 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17841.18 Da Isoelectric Point: 9.4947
>T254290 WP_000347266.1 NZ_CP102853:c593858-593394 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A836NGD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |