Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 104792..105045 | Replicon | plasmid pKP0079-2 |
| Accession | NZ_CP102838 | ||
| Organism | Klebsiella pneumoniae strain KP0079 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NV396_RS28315 | Protein ID | WP_001312851.1 |
| Coordinates | 104896..105045 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 104792..104851 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV396_RS28275 (100174) | 100174..100518 | - | 345 | Protein_124 | IS6-like element IS26 family transposase | - |
| NV396_RS28280 (100570) | 100570..101274 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NV396_RS28285 (101299) | 101299..101499 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| NV396_RS28290 (101519) | 101519..102265 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| NV396_RS28295 (102320) | 102320..102880 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| NV396_RS28300 (103012) | 103012..103212 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| NV396_RS28305 (103598) | 103598..104197 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| NV396_RS28310 (104259) | 104259..104591 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (104792) | 104792..104851 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (104792) | 104792..104851 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (104792) | 104792..104851 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (104792) | 104792..104851 | - | 60 | NuclAT_1 | - | Antitoxin |
| NV396_RS28315 (104896) | 104896..105045 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NV396_RS28320 (105329) | 105329..105577 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| NV396_RS28325 (105692) | 105692..105870 | + | 179 | Protein_134 | protein CopA/IncA | - |
| NV396_RS28330 (105889) | 105889..106746 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| NV396_RS28335 (107685) | 107685..108338 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| NV396_RS28340 (108431) | 108431..108688 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NV396_RS28345 (108621) | 108621..109022 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NV396_RS28350 (109271) | 109271..109686 | + | 416 | Protein_139 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaSHV-12 / blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..135440 | 135440 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T254258 WP_001312851.1 NZ_CP102838:104896-105045 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT254258 NZ_CP102838:c104851-104792 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
