Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 5497..5766 | Replicon | plasmid pKP0079-2 |
| Accession | NZ_CP102838 | ||
| Organism | Klebsiella pneumoniae strain KP0079 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | NV396_RS27695 | Protein ID | WP_001372321.1 |
| Coordinates | 5641..5766 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 5497..5562 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV396_RS27665 | 1207..1734 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| NV396_RS27670 | 1792..2025 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| NV396_RS27675 | 2086..4109 | + | 2024 | Protein_4 | ParB/RepB/Spo0J family partition protein | - |
| NV396_RS27680 | 4178..4612 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| NV396_RS27685 | 4609..5328 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 5340..5564 | + | 225 | NuclAT_0 | - | - |
| - | 5340..5564 | + | 225 | NuclAT_0 | - | - |
| - | 5340..5564 | + | 225 | NuclAT_0 | - | - |
| - | 5340..5564 | + | 225 | NuclAT_0 | - | - |
| - | 5497..5562 | - | 66 | - | - | Antitoxin |
| NV396_RS27690 | 5550..5699 | + | 150 | Protein_7 | plasmid maintenance protein Mok | - |
| NV396_RS27695 | 5641..5766 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| NV396_RS27700 | 6085..6381 | - | 297 | Protein_9 | hypothetical protein | - |
| NV396_RS27705 | 6681..6977 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| NV396_RS27710 | 7088..7909 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| NV396_RS27715 | 8206..8853 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| NV396_RS27720 | 9130..9513 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| NV396_RS27725 | 9794..10498 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaSHV-12 / blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..135440 | 135440 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T254256 WP_001372321.1 NZ_CP102838:5641-5766 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT254256 NZ_CP102838:c5562-5497 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|