Detailed information of TA system TA254256

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 5497..5766
• Replicon: plasmid pKP0079-2
• Accession: NZ_CP102838
• Organism: Klebsiella pneumoniae strain KP0079

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NV396_RS27695
• Protein ID: WP_001372321.1
• Coordinates: 5641..5766 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	5497..5562 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NV396_RS27665	1207..1734	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
NV396_RS27670	1792..2025	+	234	WP_000006003.1	DUF905 family protein	-
NV396_RS27675	2086..4109	+	2024	Protein_4	ParB/RepB/Spo0J family partition protein	-
NV396_RS27680	4178..4612	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
NV396_RS27685	4609..5328	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	5340..5564	+	225	NuclAT_0	-	-
-	5340..5564	+	225	NuclAT_0	-	-
-	5340..5564	+	225	NuclAT_0	-	-
-	5340..5564	+	225	NuclAT_0	-	-
-	5497..5562	-	66	-	-	Antitoxin
NV396_RS27690	5550..5699	+	150	Protein_7	plasmid maintenance protein Mok	-
NV396_RS27695	5641..5766	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NV396_RS27700	6085..6381	-	297	Protein_9	hypothetical protein	-
NV396_RS27705	6681..6977	+	297	WP_001272251.1	hypothetical protein	-
NV396_RS27710	7088..7909	+	822	WP_001234445.1	DUF932 domain-containing protein	-
NV396_RS27715	8206..8853	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
NV396_RS27720	9130..9513	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NV396_RS27725	9794..10498	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaSHV-12 / blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB	-	1..135440	135440

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T254256 WP_001372321.1 NZ_CP102838:5641-5766 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT254256 NZ_CP102838:c5562-5497 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin