Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 9617..10268 | Replicon | plasmid pAB3927 |
| Accession | NZ_CP102832 | ||
| Organism | Acinetobacter baumannii strain AB3927 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | N8YFZ1 |
| Locus tag | NV385_RS19370 | Protein ID | WP_000269904.1 |
| Coordinates | 9912..10268 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NV385_RS19365 | Protein ID | WP_001129974.1 |
| Coordinates | 9617..9919 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV385_RS19335 (NV385_19335) | 4629..4928 | + | 300 | WP_000358348.1 | hypothetical protein | - |
| NV385_RS19340 (NV385_19340) | 5196..5483 | + | 288 | WP_000438827.1 | BrnT family toxin | - |
| NV385_RS19345 (NV385_19345) | 5470..5784 | + | 315 | WP_001983304.1 | BrnA antitoxin family protein | - |
| NV385_RS19350 (NV385_19350) | 5912..8323 | + | 2412 | WP_000932953.1 | TonB-dependent receptor ZnuD2 | - |
| NV385_RS19355 (NV385_19355) | 8628..9089 | + | 462 | WP_000761346.1 | DIP1984 family protein | - |
| NV385_RS19360 (NV385_19360) | 9415..9624 | - | 210 | WP_000069474.1 | hypothetical protein | - |
| NV385_RS19365 (NV385_19365) | 9617..9919 | - | 303 | WP_001129974.1 | XRE family transcriptional regulator | Antitoxin |
| NV385_RS19370 (NV385_19370) | 9912..10268 | - | 357 | WP_000269904.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NV385_RS19375 (NV385_19375) | 10834..11133 | - | 300 | WP_000358348.1 | hypothetical protein | - |
| NV385_RS19380 (NV385_19380) | 11250..12011 | - | 762 | WP_000425105.1 | hypothetical protein | - |
| NV385_RS19385 (NV385_19385) | 12316..13485 | + | 1170 | WP_002134206.1 | MobA/MobL family protein | - |
| NV385_RS19390 (NV385_19390) | 14082..15017 | + | 936 | WP_001292329.1 | replication initiation protein RepM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..22388 | 22388 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13488.42 Da Isoelectric Point: 5.7104
>T254219 WP_000269904.1 NZ_CP102832:c10268-9912 [Acinetobacter baumannii]
MWTVITTDLFNEWLEQQDEATQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKSNKKRFYTEMLAIADEQYALHLSTLGDQSNG
MWTVITTDLFNEWLEQQDEATQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKSNKKRFYTEMLAIADEQYALHLSTLGDQSNG
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|