Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 192678..193432 | Replicon | chromosome |
| Accession | NZ_CP102827 | ||
| Organism | Salmonella enterica subsp. enterica serovar Indiana strain XZ14C1328 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A4Y6MJG6 |
| Locus tag | NV345_RS00955 | Protein ID | WP_000558165.1 |
| Coordinates | 193121..193432 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NV345_RS00950 | Protein ID | WP_001259009.1 |
| Coordinates | 192678..193124 (-) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV345_RS00920 (187854) | 187854..188750 | + | 897 | WP_023227075.1 | sugar kinase | - |
| NV345_RS00925 (188784) | 188784..189587 | + | 804 | WP_000059689.1 | DeoR family transcriptional regulator | - |
| NV345_RS00930 (189778) | 189778..190377 | + | 600 | WP_023227076.1 | glucose-1-phosphatase | - |
| NV345_RS00935 (190371) | 190371..191243 | + | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| NV345_RS00940 (191240) | 191240..191677 | + | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| NV345_RS00945 (191722) | 191722..192663 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NV345_RS00950 (192678) | 192678..193124 | - | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NV345_RS00955 (193121) | 193121..193432 | - | 312 | WP_000558165.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NV345_RS00960 (193518) | 193518..194447 | - | 930 | WP_001162861.1 | alpha/beta hydrolase | - |
| NV345_RS00965 (194652) | 194652..194894 | + | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
| NV345_RS00970 (194894) | 194894..195268 | + | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | - |
| NV345_RS00975 (195306) | 195306..196235 | - | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NV345_RS00980 (196232) | 196232..196867 | - | 636 | WP_000829028.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NV345_RS00985 (196864) | 196864..197766 | - | 903 | WP_051129234.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12433.34 Da Isoelectric Point: 8.4020
>T254201 WP_000558165.1 NZ_CP102827:c193432-193121 [Salmonella enterica subsp. enterica serovar Indiana]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT254201 WP_001259009.1 NZ_CP102827:c193124-192678 [Salmonella enterica subsp. enterica serovar Indiana]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|