Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 33773..34431 | Replicon | plasmid unnamed4 |
Accession | NZ_CP102820 | ||
Organism | Acinetobacter baumannii strain AB186-VUB |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | L2Z19_RS18865 | Protein ID | WP_000312250.1 |
Coordinates | 34072..34431 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | L2Z19_RS18860 | Protein ID | WP_099715069.1 |
Coordinates | 33773..34072 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L2Z19_RS18830 (L2Z19_18855) | 29300..29434 | + | 135 | WP_261944414.1 | hypothetical protein | - |
L2Z19_RS18835 (L2Z19_18860) | 29511..29852 | + | 342 | WP_079757915.1 | hypothetical protein | - |
L2Z19_RS18840 (L2Z19_18865) | 30222..31310 | - | 1089 | Protein_45 | IS4-like element ISAba1 family transposase | - |
L2Z19_RS18845 (L2Z19_18870) | 31408..32228 | + | 821 | Protein_46 | OXA-23 family carbapenem-hydrolyzing class D beta-lactamase | - |
L2Z19_RS18850 (L2Z19_18875) | 32333..32992 | - | 660 | Protein_47 | ATP-binding protein | - |
L2Z19_RS18855 (L2Z19_18880) | 33033..33236 | + | 204 | WP_000389756.1 | hypothetical protein | - |
L2Z19_RS18860 (L2Z19_18885) | 33773..34072 | - | 300 | WP_099715069.1 | XRE family transcriptional regulator | Antitoxin |
L2Z19_RS18865 (L2Z19_18890) | 34072..34431 | - | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
L2Z19_RS18870 (L2Z19_18895) | 34632..35198 | + | 567 | WP_000710385.1 | hypothetical protein | - |
L2Z19_RS18875 (L2Z19_18900) | 35247..35429 | + | 183 | WP_000373385.1 | hypothetical protein | - |
L2Z19_RS18880 (L2Z19_18905) | 35496..36194 | + | 699 | WP_000873188.1 | hypothetical protein | - |
L2Z19_RS18885 (L2Z19_18910) | 36457..36714 | + | 258 | WP_002013718.1 | hypothetical protein | - |
L2Z19_RS18890 (L2Z19_18915) | 36861..37538 | + | 678 | WP_261944415.1 | hypothetical protein | - |
L2Z19_RS18895 (L2Z19_18920) | 38589..38903 | + | 315 | WP_000708714.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaOXA-23 / aph(3')-VIa | - | 1..76819 | 76819 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T254195 WP_000312250.1 NZ_CP102820:c34431-34072 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|