Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 15454..16112 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP102817 | ||
| Organism | Acinetobacter baumannii strain AB32-VUB | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | L2Z47_RS19065 | Protein ID | WP_000312250.1 |
| Coordinates | 15454..15813 (+) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | L2Z47_RS19070 | Protein ID | WP_001096429.1 |
| Coordinates | 15813..16112 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L2Z47_RS19035 (L2Z47_19055) | 10822..11814 | - | 993 | WP_001381192.1 | TniB family NTP-binding protein | - |
| L2Z47_RS19040 (L2Z47_19060) | 11817..12224 | - | 408 | Protein_14 | Mu transposase C-terminal domain-containing protein | - |
| L2Z47_RS19045 (L2Z47_19065) | 12850..13143 | - | 294 | WP_002013734.1 | hypothetical protein | - |
| L2Z47_RS19050 (L2Z47_19070) | 13210..13593 | - | 384 | WP_000654348.1 | hypothetical protein | - |
| L2Z47_RS19055 (L2Z47_19075) | 13948..14433 | - | 486 | WP_261944957.1 | hypothetical protein | - |
| L2Z47_RS19060 (L2Z47_19080) | 14684..15295 | - | 612 | WP_261944958.1 | hypothetical protein | - |
| L2Z47_RS19065 (L2Z47_19085) | 15454..15813 | + | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| L2Z47_RS19070 (L2Z47_19090) | 15813..16112 | + | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
| L2Z47_RS19075 (L2Z47_19095) | 16917..17183 | - | 267 | WP_261944960.1 | hypothetical protein | - |
| L2Z47_RS19080 (L2Z47_19100) | 17233..17592 | - | 360 | WP_003311168.1 | hypothetical protein | - |
| L2Z47_RS19085 (L2Z47_19105) | 17600..17791 | - | 192 | WP_261944961.1 | hypothetical protein | - |
| L2Z47_RS19090 (L2Z47_19110) | 17811..18029 | - | 219 | WP_001043201.1 | hypothetical protein | - |
| L2Z47_RS19095 (L2Z47_19115) | 18089..18718 | - | 630 | WP_261944963.1 | hypothetical protein | - |
| L2Z47_RS19100 (L2Z47_19120) | 18735..18914 | - | 180 | WP_000387630.1 | hypothetical protein | - |
| L2Z47_RS19105 (L2Z47_19125) | 18890..19282 | - | 393 | WP_261944964.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | cmlA1 / aadA2 / aph(3'')-Ib / aph(6)-Id / blaGES-12 / aac(6')-Ib / dfrA7 / qacE / sul1 / blaCARB-49 / blaOXA-23 / aph(3')-VIa | - | 1..88562 | 88562 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T254193 WP_000312250.1 NZ_CP102817:15454-15813 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|