Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 15454..16112 Replicon plasmid unnamed3
Accession NZ_CP102817
Organism Acinetobacter baumannii strain AB32-VUB

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag L2Z47_RS19065 Protein ID WP_000312250.1
Coordinates 15454..15813 (+) Length 120 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag L2Z47_RS19070 Protein ID WP_001096429.1
Coordinates 15813..16112 (+) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
L2Z47_RS19035 (L2Z47_19055) 10822..11814 - 993 WP_001381192.1 TniB family NTP-binding protein -
L2Z47_RS19040 (L2Z47_19060) 11817..12224 - 408 Protein_14 Mu transposase C-terminal domain-containing protein -
L2Z47_RS19045 (L2Z47_19065) 12850..13143 - 294 WP_002013734.1 hypothetical protein -
L2Z47_RS19050 (L2Z47_19070) 13210..13593 - 384 WP_000654348.1 hypothetical protein -
L2Z47_RS19055 (L2Z47_19075) 13948..14433 - 486 WP_261944957.1 hypothetical protein -
L2Z47_RS19060 (L2Z47_19080) 14684..15295 - 612 WP_261944958.1 hypothetical protein -
L2Z47_RS19065 (L2Z47_19085) 15454..15813 + 360 WP_000312250.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
L2Z47_RS19070 (L2Z47_19090) 15813..16112 + 300 WP_001096429.1 XRE family transcriptional regulator Antitoxin
L2Z47_RS19075 (L2Z47_19095) 16917..17183 - 267 WP_261944960.1 hypothetical protein -
L2Z47_RS19080 (L2Z47_19100) 17233..17592 - 360 WP_003311168.1 hypothetical protein -
L2Z47_RS19085 (L2Z47_19105) 17600..17791 - 192 WP_261944961.1 hypothetical protein -
L2Z47_RS19090 (L2Z47_19110) 17811..18029 - 219 WP_001043201.1 hypothetical protein -
L2Z47_RS19095 (L2Z47_19115) 18089..18718 - 630 WP_261944963.1 hypothetical protein -
L2Z47_RS19100 (L2Z47_19120) 18735..18914 - 180 WP_000387630.1 hypothetical protein -
L2Z47_RS19105 (L2Z47_19125) 18890..19282 - 393 WP_261944964.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid cmlA1 / aadA2 / aph(3'')-Ib / aph(6)-Id / blaGES-12 / aac(6')-Ib / dfrA7 / qacE / sul1 / blaCARB-49 / blaOXA-23 / aph(3')-VIa - 1..88562 88562


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(14-109)

Antitoxin

HigA2-like, helix-turn-helix domain

(12-88)


Sequences

Toxin        


Download         Length: 120 a.a.        Molecular weight: 13751.62 Da        Isoelectric Point: 4.8212

>T254193 WP_000312250.1 NZ_CP102817:15454-15813 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK

Download         Length: 360 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 11012.93 Da        Isoelectric Point: 10.4856

>AT254193 WP_001096429.1 NZ_CP102817:15813-16112 [Acinetobacter baumannii]
MAKLNDIISKRSPESQQRIKKMANQMLLDINLSNLREELKISQAEIAKNLGVSQAAISKREKLGKDLKISSLKEYVEAMG
GKVRLDVELPNGKHVAISI

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References