Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 2028..2613 | Replicon | plasmid pAOR07BL-3 |
| Accession | NZ_CP102765 | ||
| Organism | Acinetobacter baumannii strain AOR07-BL | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | N8ZPD7 |
| Locus tag | NU955_RS19320 | Protein ID | WP_000897309.1 |
| Coordinates | 2293..2613 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NU955_RS19315 | Protein ID | WP_000369780.1 |
| Coordinates | 2028..2300 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NU955_RS19305 | 71..898 | + | 828 | WP_032495421.1 | AraC family transcriptional regulator | - |
| NU955_RS19310 | 948..1553 | + | 606 | WP_000447788.1 | LysE family translocator | - |
| NU955_RS19315 | 2028..2300 | - | 273 | WP_000369780.1 | NadS family protein | Antitoxin |
| NU955_RS19320 | 2293..2613 | - | 321 | WP_000897309.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NU955_RS19325 | 2800..2997 | - | 198 | WP_000476222.1 | hypothetical protein | - |
| NU955_RS19330 | 3064..3291 | - | 228 | WP_000921865.1 | hypothetical protein | - |
| NU955_RS19335 | 3390..3605 | - | 216 | WP_000071892.1 | cold-shock protein | - |
| NU955_RS19340 | 3931..4650 | - | 720 | WP_001218546.1 | hypothetical protein | - |
| NU955_RS19345 | 4668..4934 | - | 267 | WP_188200041.1 | mobilization protein | - |
| NU955_RS19350 | 5145..6581 | + | 1437 | WP_059264791.1 | MobQ family relaxase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaOXA-58 | - | 1..31683 | 31683 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12209.01 Da Isoelectric Point: 7.9835
>T254162 WP_000897309.1 NZ_CP102765:c2613-2293 [Acinetobacter baumannii]
MLFIETSIFTKQIKELVSDEEYRQLQQDLLVQPDKGDLIKNGGGIRKVRCAQGNKGKSGGIRVIYYWVTEDDQIFFLVAY
PKSVKDNLTDKETSILRQLVKEQFHG
MLFIETSIFTKQIKELVSDEEYRQLQQDLLVQPDKGDLIKNGGGIRKVRCAQGNKGKSGGIRVIYYWVTEDDQIFFLVAY
PKSVKDNLTDKETSILRQLVKEQFHG
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|