Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 26099..26750 Replicon plasmid pAOR07BL-1
Accession NZ_CP102763
Organism Acinetobacter baumannii strain AOR07-BL

Toxin (Protein)


Gene name higB Uniprot ID S3SZA7
Locus tag NU955_RS18330 Protein ID WP_000269903.1
Coordinates 26394..26750 (-) Length 119 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NU955_RS18325 Protein ID WP_001140619.1
Coordinates 26099..26401 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NU955_RS18275 21604..22161 + 558 Protein_21 hypothetical protein -
NU955_RS18280 22185..22409 + 225 WP_005130229.1 hypothetical protein -
NU955_RS18285 22693..22980 - 288 WP_109850684.1 helix-turn-helix transcriptional regulator -
NU955_RS18290 22967..23188 - 222 Protein_24 type II toxin-antitoxin system RelE/ParE family toxin -
NU955_RS18295 23432..23752 - 321 WP_004704395.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NU955_RS18300 23940..24068 + 129 WP_002123981.1 AAA family ATPase -
NU955_RS18305 24122..24328 + 207 WP_235824376.1 AAA family ATPase -
NU955_RS18310 24256..24801 + 546 Protein_28 IS5-like element ISAba13 family transposase -
NU955_RS18315 25560..25772 + 213 WP_016653394.1 hypothetical protein -
NU955_RS18320 25897..26106 - 210 WP_000069471.1 hypothetical protein -
NU955_RS18325 26099..26401 - 303 WP_001140619.1 XRE family transcriptional regulator Antitoxin
NU955_RS18330 26394..26750 - 357 WP_000269903.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NU955_RS18335 27458..27994 + 537 WP_009501148.1 porin family protein -
NU955_RS18340 28164..28394 - 231 WP_009501150.1 hypothetical protein -
NU955_RS18345 28731..29102 + 372 WP_009501156.1 RcnB family protein -
NU955_RS18350 29166..30099 - 934 Protein_36 IS5-like element ISAba13 family transposase -
NU955_RS18355 30327..30608 - 282 WP_000985610.1 putative addiction module antidote protein -
NU955_RS18360 30609..30911 - 303 WP_000286963.1 type II toxin-antitoxin system RelE/ParE family toxin -
NU955_RS18365 31073..31612 - 540 WP_002055813.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..133579 133579
- inside IScluster/Tn - - 24319..43036 18717


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

HigA2-like, helix-turn-helix domain

(13-89)


Sequences

Toxin        


Download         Length: 119 a.a.        Molecular weight: 13486.45 Da        Isoelectric Point: 7.1645

>T254159 WP_000269903.1 NZ_CP102763:c26750-26394 [Acinetobacter baumannii]
MWTVITTDLFNEWLAQQDQSTQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKGGKKRFYKEMLDIADQQYEIHLSTLGDQSNG

Download         Length: 357 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11206.01 Da        Isoelectric Point: 6.7282

>AT254159 WP_001140619.1 NZ_CP102763:c26401-26099 [Acinetobacter baumannii]
MAKTLQELLANRSPESQARIQQMADELLLETQLHLIREELEISQKELAATLGIKQPSLSAIENRGHDLKISTMKKYVEAM
GGKLRIDVELPTGKHIGFNV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A836MG83

Antitoxin

Source ID Structure

References