Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4407608..4408332 | Replicon | chromosome |
| Accession | NZ_CP102749 | ||
| Organism | Pectobacterium parvum strain YT22221 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A093VC08 |
| Locus tag | NV347_RS19865 | Protein ID | WP_039482109.1 |
| Coordinates | 4408021..4408332 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NV347_RS19860 | Protein ID | WP_039482106.1 |
| Coordinates | 4407608..4408024 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV347_RS19835 (NV347_19835) | 4402975..4404327 | + | 1353 | WP_039512786.1 | pyridoxal-dependent decarboxylase | - |
| NV347_RS19840 (NV347_19840) | 4404421..4404879 | - | 459 | WP_010286715.1 | hypothetical protein | - |
| NV347_RS19845 (NV347_19845) | 4405110..4406438 | + | 1329 | WP_161546580.1 | IS4 family transposase | - |
| NV347_RS19850 (NV347_19850) | 4406744..4407004 | + | 261 | WP_039482487.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NV347_RS19855 (NV347_19855) | 4407078..4407449 | + | 372 | WP_039482489.1 | helix-turn-helix transcriptional regulator | - |
| NV347_RS19860 (NV347_19860) | 4407608..4408024 | - | 417 | WP_039482106.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NV347_RS19865 (NV347_19865) | 4408021..4408332 | - | 312 | WP_039482109.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NV347_RS19870 (NV347_19870) | 4409761..4410054 | - | 294 | WP_102117148.1 | type I-E CRISPR-associated endoribonuclease Cas2e | - |
| NV347_RS19875 (NV347_19875) | 4410055..4410972 | - | 918 | WP_012822191.1 | type I-E CRISPR-associated endonuclease Cas1e | - |
| NV347_RS19880 (NV347_19880) | 4411000..4411647 | - | 648 | WP_039512784.1 | type I-E CRISPR-associated protein Cas6/Cse3/CasE | - |
| NV347_RS19885 (NV347_19885) | 4411647..4412381 | - | 735 | WP_165708412.1 | type I-E CRISPR-associated protein Cas5/CasD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4407078..4417118 | 10040 | |
| - | flank | IS/Tn | - | - | 4405110..4406438 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12450.29 Da Isoelectric Point: 9.8530
>T254138 WP_039482109.1 NZ_CP102749:c4408332-4408021 [Pectobacterium parvum]
MHVISRAPFDTATTQFPNQAAALDDLYRVIKREMYATPDDMKKRFPSLDRMKYREKWWVIDIGGGHLRVMFFADFERGKI
FIKHITSHAEYDRLTEYYRRNKE
MHVISRAPFDTATTQFPNQAAALDDLYRVIKREMYATPDDMKKRFPSLDRMKYREKWWVIDIGGGHLRVMFFADFERGKI
FIKHITSHAEYDRLTEYYRRNKE
Download Length: 312 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15375.68 Da Isoelectric Point: 4.8037
>AT254138 WP_039482106.1 NZ_CP102749:c4408024-4407608 [Pectobacterium parvum]
MMYADAIKAANNLTSIVPFLGGSASRKDYEDALKLTEYLIESEPDSPLIDMLTAKIDKYEDDAPEFAAFNERVKALPAGI
ALLRVLMDQHQLTQSDFEAEIGKKSLVSRILKGERTLTLDHMRALAKRFNIPVSAFVD
MMYADAIKAANNLTSIVPFLGGSASRKDYEDALKLTEYLIESEPDSPLIDMLTAKIDKYEDDAPEFAAFNERVKALPAGI
ALLRVLMDQHQLTQSDFEAEIGKKSLVSRILKGERTLTLDHMRALAKRFNIPVSAFVD
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|