Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HTH_XRE
Location 3718683..3719417 Replicon chromosome
Accession NZ_CP102749
Organism Pectobacterium parvum strain YT22221

Toxin (Protein)


Gene name higB Uniprot ID C6DCB3
Locus tag NV347_RS16730 Protein ID WP_015841346.1
Coordinates 3719103..3719417 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NV347_RS16725 Protein ID WP_039512487.1
Coordinates 3718683..3719024 (-) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NV347_RS16675 (NV347_16675) 3713877..3715061 + 1185 WP_044208982.1 phage major capsid protein, P2 family -
NV347_RS16680 (NV347_16680) 3715065..3715724 + 660 WP_258210263.1 terminase endonuclease subunit -
NV347_RS16685 (NV347_16685) 3715816..3716319 + 504 WP_258210264.1 head completion/stabilization protein -
NV347_RS16690 (NV347_16690) 3716319..3716522 + 204 WP_005967821.1 tail protein X -
NV347_RS16695 (NV347_16695) 3716513..3716734 + 222 WP_033071244.1 HP1 family phage holin -
NV347_RS16700 (NV347_16700) 3716718..3717227 + 510 WP_230242423.1 lysozyme -
NV347_RS16705 (NV347_16705) 3717224..3717667 + 444 WP_039512490.1 Rz-like lysis system protein LysB -
NV347_RS16710 (NV347_16710) 3717552..3717794 + 243 WP_225969782.1 Rz1-like lysis system protein LysC -
NV347_RS16715 (NV347_16715) 3717757..3718212 + 456 WP_039512489.1 phage tail protein -
NV347_RS16720 (NV347_16720) 3718205..3718654 + 450 WP_039512488.1 phage virion morphogenesis protein -
NV347_RS16725 (NV347_16725) 3718683..3719024 - 342 WP_039512487.1 HigA family addiction module antitoxin Antitoxin
NV347_RS16730 (NV347_16730) 3719103..3719417 - 315 WP_015841346.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NV347_RS16735 (NV347_16735) 3719969..3720580 + 612 WP_258210265.1 KilA-N domain-containing protein -
NV347_RS16740 (NV347_16740) 3720625..3721692 - 1068 WP_258210266.1 hypothetical protein -
NV347_RS16745 (NV347_16745) 3721785..3722420 + 636 WP_258210267.1 phage baseplate assembly protein V -
NV347_RS16750 (NV347_16750) 3722417..3722761 + 345 WP_239768151.1 GPW/gp25 family protein -
NV347_RS16755 (NV347_16755) 3722765..3723673 + 909 WP_258210268.1 baseplate assembly protein -
NV347_RS16760 (NV347_16760) 3723666..3724277 + 612 WP_258210269.1 phage tail protein I -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3699946..3733340 33394


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(9-98)

Antitoxin

Cro/C1-type helix-turn-helix domain

(24-70)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 12228.00 Da        Isoelectric Point: 9.9719

>T254134 WP_015841346.1 NZ_CP102749:c3719417-3719103 [Pectobacterium parvum]
MQKMRSIHSFRDQWLEDFFMYGKSHKKIPADVVTSLSRKLDIINAAVSAKDLRSPPGNRYENLNPPLGEYSSIRVNIQYR
LIFKWVDGKAEDIYLDDHGYKKHK

Download         Length: 315 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12958.54 Da        Isoelectric Point: 4.3501

>AT254134 WP_039512487.1 NZ_CP102749:c3719024-3718683 [Pectobacterium parvum]
MAQAQRKPTSVGDVLLYEYLEPTGLKINDLAEMLNVHRNTISALVNNNRKLTVDMAFRLAKAFDTSVDFWLNLQNSVDVW
EVENDARTQEEISRITTLEDFLAQRDENVKDVS

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7V8Q8Q5

Antitoxin

Source ID Structure

References