Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 137587..138441 | Replicon | chromosome |
Accession | NZ_CP102749 | ||
Organism | Pectobacterium parvum strain YT22221 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A6P1S1D5 |
Locus tag | NV347_RS00570 | Protein ID | WP_039487843.1 |
Coordinates | 137587..138075 (-) | Length | 163 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | A0A6P1S4C9 |
Locus tag | NV347_RS00575 | Protein ID | WP_039487859.1 |
Coordinates | 138100..138441 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV347_RS00550 (NV347_00550) | 134110..134778 | + | 669 | WP_039487849.1 | 6-phosphogluconate phosphatase | - |
NV347_RS00555 (NV347_00555) | 134798..135526 | - | 729 | WP_039487847.1 | amino acid ABC transporter permease | - |
NV347_RS00560 (NV347_00560) | 135528..136271 | - | 744 | WP_039487846.1 | amino acid ABC transporter permease | - |
NV347_RS00565 (NV347_00565) | 136552..137388 | - | 837 | WP_039487845.1 | ABC transporter substrate-binding protein | - |
NV347_RS00570 (NV347_00570) | 137587..138075 | - | 489 | WP_039487843.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
NV347_RS00575 (NV347_00575) | 138100..138441 | - | 342 | WP_039487859.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
NV347_RS00580 (NV347_00580) | 138774..139952 | - | 1179 | WP_039487841.1 | benzoate/H(+) symporter BenE family transporter | - |
NV347_RS00585 (NV347_00585) | 140044..140610 | + | 567 | WP_039487839.1 | XRE family transcriptional regulator | - |
NV347_RS00590 (NV347_00590) | 140671..141402 | - | 732 | WP_039487837.1 | phosphate signaling complex protein PhoU | - |
NV347_RS00595 (NV347_00595) | 141415..142188 | - | 774 | WP_039487836.1 | phosphate ABC transporter ATP-binding protein PstB | - |
NV347_RS00600 (NV347_00600) | 142275..143162 | - | 888 | WP_039275952.1 | phosphate ABC transporter permease PstA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 163 a.a. Molecular weight: 18690.49 Da Isoelectric Point: 6.8563
>T254125 WP_039487843.1 NZ_CP102749:c138075-137587 [Pectobacterium parvum]
MEYLDVNGWKICFHSCFLQQIAELAQKVVELKAAKPDEYLGKKETKLLHAIERVIEEWIAVDPLNPQYRQGDTLGDEFKH
WFRAKFLSQFRLFYRCSAEHKTIIIGWVNDFDTLRAYGSKTDAYKVFAGMLRAGEPPDDWEKLLNEAKAITATTSIPGFL
GK
MEYLDVNGWKICFHSCFLQQIAELAQKVVELKAAKPDEYLGKKETKLLHAIERVIEEWIAVDPLNPQYRQGDTLGDEFKH
WFRAKFLSQFRLFYRCSAEHKTIIIGWVNDFDTLRAYGSKTDAYKVFAGMLRAGEPPDDWEKLLNEAKAITATTSIPGFL
GK
Download Length: 489 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6P1S1D5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6P1S4C9 |