Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 31452..31716 Replicon plasmid pYUAHMCS8-1
Accession NZ_CP102740
Organism Salmonella enterica subsp. enterica serovar Kentucky strain AH19MCS8

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag NWA03_RS23925 Protein ID WP_001331364.1
Coordinates 31564..31716 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 31452..31509 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWA03_RS23910 (27790) 27790..28860 - 1071 WP_000151579.1 IncI1-type conjugal transfer protein TrbB -
NWA03_RS23915 (28879) 28879..30087 - 1209 WP_001383960.1 IncI1-type conjugal transfer protein TrbA -
NWA03_RS23920 (30305) 30305..31258 - 954 WP_021513958.1 hypothetical protein -
- (31452) 31452..31509 - 58 NuclAT_0 - Antitoxin
- (31452) 31452..31509 - 58 NuclAT_0 - Antitoxin
- (31452) 31452..31509 - 58 NuclAT_0 - Antitoxin
- (31452) 31452..31509 - 58 NuclAT_0 - Antitoxin
NWA03_RS23925 (31564) 31564..31716 + 153 WP_001331364.1 Hok/Gef family protein Toxin
NWA03_RS23930 (31788) 31788..32039 - 252 WP_001291964.1 hypothetical protein -
NWA03_RS23935 (32401) 32401..32633 + 233 Protein_39 hypothetical protein -
NWA03_RS23940 (32698) 32698..32874 - 177 WP_001054901.1 hypothetical protein -
NWA03_RS23945 (33206) 33206..33415 + 210 WP_000062602.1 HEAT repeat domain-containing protein -
NWA03_RS23950 (33487) 33487..34149 - 663 WP_060527638.1 plasmid IncI1-type surface exclusion protein ExcA -
NWA03_RS23955 (34220) 34220..36388 - 2169 WP_000698368.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..85309 85309


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T254102 WP_001331364.1 NZ_CP102740:31564-31716 [Salmonella enterica subsp. enterica serovar Kentucky]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT254102 NZ_CP102740:c31509-31452 [Salmonella enterica subsp. enterica serovar Kentucky]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References