Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 31452..31716 | Replicon | plasmid pYUAHMCS8-1 |
| Accession | NZ_CP102740 | ||
| Organism | Salmonella enterica subsp. enterica serovar Kentucky strain AH19MCS8 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | NWA03_RS23925 | Protein ID | WP_001331364.1 |
| Coordinates | 31564..31716 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 31452..31509 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWA03_RS23910 (27790) | 27790..28860 | - | 1071 | WP_000151579.1 | IncI1-type conjugal transfer protein TrbB | - |
| NWA03_RS23915 (28879) | 28879..30087 | - | 1209 | WP_001383960.1 | IncI1-type conjugal transfer protein TrbA | - |
| NWA03_RS23920 (30305) | 30305..31258 | - | 954 | WP_021513958.1 | hypothetical protein | - |
| - (31452) | 31452..31509 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (31452) | 31452..31509 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (31452) | 31452..31509 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (31452) | 31452..31509 | - | 58 | NuclAT_0 | - | Antitoxin |
| NWA03_RS23925 (31564) | 31564..31716 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| NWA03_RS23930 (31788) | 31788..32039 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| NWA03_RS23935 (32401) | 32401..32633 | + | 233 | Protein_39 | hypothetical protein | - |
| NWA03_RS23940 (32698) | 32698..32874 | - | 177 | WP_001054901.1 | hypothetical protein | - |
| NWA03_RS23945 (33206) | 33206..33415 | + | 210 | WP_000062602.1 | HEAT repeat domain-containing protein | - |
| NWA03_RS23950 (33487) | 33487..34149 | - | 663 | WP_060527638.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| NWA03_RS23955 (34220) | 34220..36388 | - | 2169 | WP_000698368.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..85309 | 85309 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T254102 WP_001331364.1 NZ_CP102740:31564-31716 [Salmonella enterica subsp. enterica serovar Kentucky]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT254102 NZ_CP102740:c31509-31452 [Salmonella enterica subsp. enterica serovar Kentucky]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|