Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 224007..224761 | Replicon | chromosome |
| Accession | NZ_CP102719 | ||
| Organism | Salmonella enterica subsp. enterica serovar Kentucky isolate AH19MCS1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | NWA05_RS01145 | Protein ID | WP_000558166.1 |
| Coordinates | 224450..224761 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NWA05_RS01140 | Protein ID | WP_001259011.1 |
| Coordinates | 224007..224453 (-) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWA05_RS01110 (219183) | 219183..220079 | + | 897 | WP_001520529.1 | sugar kinase | - |
| NWA05_RS01115 (220113) | 220113..220916 | + | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NWA05_RS01120 (221107) | 221107..221706 | + | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NWA05_RS01125 (221700) | 221700..222572 | + | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| NWA05_RS01130 (222569) | 222569..223006 | + | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| NWA05_RS01135 (223051) | 223051..223992 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NWA05_RS01140 (224007) | 224007..224453 | - | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NWA05_RS01145 (224450) | 224450..224761 | - | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NWA05_RS01150 (224847) | 224847..225776 | - | 930 | WP_001127698.1 | alpha/beta hydrolase | - |
| NWA05_RS01155 (225994) | 225994..226305 | + | 312 | WP_023138876.1 | hypothetical protein | - |
| NWA05_RS01160 (226306) | 226306..226596 | + | 291 | WP_000362052.1 | DNA-binding transcriptional regulator | - |
| NWA05_RS01165 (226643) | 226643..227572 | - | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NWA05_RS01170 (227569) | 227569..228204 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NWA05_RS01175 (228201) | 228201..229103 | - | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T254068 WP_000558166.1 NZ_CP102719:c224761-224450 [Salmonella enterica subsp. enterica serovar Kentucky]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT254068 WP_001259011.1 NZ_CP102719:c224453-224007 [Salmonella enterica subsp. enterica serovar Kentucky]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|