Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
Location | 207335..207857 | Replicon | chromosome |
Accession | NZ_CP102716 | ||
Organism | Lacticaseibacillus rhamnosus strain DM065 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | C2JUK2 |
Locus tag | NHB23_RS00915 | Protein ID | WP_005687756.1 |
Coordinates | 207335..207595 (-) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | C2JUK3 |
Locus tag | NHB23_RS00920 | Protein ID | WP_005687754.1 |
Coordinates | 207588..207857 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHB23_RS00890 (NHB23_000890) | 202751..203392 | + | 642 | WP_005690763.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
NHB23_RS00895 (NHB23_000895) | 203460..204239 | + | 780 | WP_005690765.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
NHB23_RS00900 (NHB23_000900) | 204424..205311 | + | 888 | WP_014571690.1 | L-ribulose-5-phosphate 3-epimerase | - |
NHB23_RS00905 (NHB23_000905) | 205378..206199 | - | 822 | WP_005690770.1 | Cof-type HAD-IIB family hydrolase | - |
NHB23_RS00910 (NHB23_000910) | 206396..207124 | + | 729 | WP_014571689.1 | L-ribulose-5-phosphate 4-epimerase | - |
NHB23_RS00915 (NHB23_000915) | 207335..207595 | - | 261 | WP_005687756.1 | Txe/YoeB family addiction module toxin | Toxin |
NHB23_RS00920 (NHB23_000920) | 207588..207857 | - | 270 | WP_005687754.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NHB23_RS00925 (NHB23_000925) | 208483..209283 | + | 801 | WP_005690776.1 | SDR family oxidoreductase | - |
NHB23_RS00930 (NHB23_000930) | 209310..211178 | + | 1869 | WP_014571687.1 | HTH domain-containing protein | - |
NHB23_RS00935 (NHB23_000935) | 211179..211688 | + | 510 | WP_049179682.1 | transcriptional regulator GutM | - |
NHB23_RS00940 (NHB23_000940) | 211701..212270 | + | 570 | WP_005687747.1 | PTS glucitol/sorbitol transporter subunit IIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10485.91 Da Isoelectric Point: 9.6577
>T254064 WP_005687756.1 NZ_CP102716:c207595-207335 [Lacticaseibacillus rhamnosus]
MIKTWTDDAWADYMYWHDQNDKRTIKRINQLIQAIDRDPYKGIGKPEPLRYALTGKWSRRIDQENRIIYSIEKNHINIFA
CRTHYS
MIKTWTDDAWADYMYWHDQNDKRTIKRINQLIQAIDRDPYKGIGKPEPLRYALTGKWSRRIDQENRIIYSIEKNHINIFA
CRTHYS
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249N526 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249N594 |