Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 33375..33639 | Replicon | plasmid pGN4554-4 |
| Accession | NZ_CP102698 | ||
| Organism | Escherichia coli strain GN4554 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | NV952_RS24270 | Protein ID | WP_001387489.1 |
| Coordinates | 33375..33527 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 33579..33639 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV952_RS24230 (28467) | 28467..29000 | - | 534 | WP_001221666.1 | lipocalin family protein | - |
| NV952_RS24235 (29094) | 29094..30239 | - | 1146 | WP_039023136.1 | extended-spectrum class C beta-lactamase CMY-42 | - |
| NV952_RS24245 (31444) | 31444..31542 | + | 99 | Protein_31 | ethanolamine utilization protein EutE | - |
| NV952_RS24250 (31614) | 31614..31823 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| NV952_RS24255 (32215) | 32215..32391 | + | 177 | WP_001054897.1 | hypothetical protein | - |
| NV952_RS24260 (32456) | 32456..32551 | - | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| NV952_RS24265 (33052) | 33052..33303 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| NV952_RS24270 (33375) | 33375..33527 | - | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| - (33579) | 33579..33639 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (33579) | 33579..33639 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (33579) | 33579..33639 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (33579) | 33579..33639 | + | 61 | NuclAT_0 | - | Antitoxin |
| NV952_RS24275 (33848) | 33848..34222 | + | 375 | WP_223349261.1 | hypothetical protein | - |
| NV952_RS24280 (34375) | 34375..35532 | + | 1158 | Protein_38 | IS1380-like element ISEcp1 family transposase | - |
| NV952_RS24285 (35588) | 35588..36285 | + | 698 | WP_095033700.1 | IS1-like element IS1B family transposase | - |
| NV952_RS24290 (36296) | 36296..36604 | - | 309 | WP_039023235.1 | transcription termination/antitermination NusG family protein | - |
| NV952_RS24295 (37046) | 37046..37333 | - | 288 | WP_000074855.1 | conjugal transfer protein TraA | - |
| NV952_RS24300 (37371) | 37371..37529 | - | 159 | Protein_42 | ash family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCMY-42 | - | 1..38440 | 38440 | |
| - | inside | IScluster/Tn | blaCMY-42 | - | 29094..35863 | 6769 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T254058 WP_001387489.1 NZ_CP102698:c33527-33375 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 61 bp
>AT254058 NZ_CP102698:33579-33639 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|