Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4171..4425 | Replicon | plasmid pGN4554-3 |
| Accession | NZ_CP102697 | ||
| Organism | Escherichia coli strain GN4554 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NV952_RS23805 | Protein ID | WP_001312851.1 |
| Coordinates | 4171..4320 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 4364..4425 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV952_RS23775 (194) | 194..595 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NV952_RS23780 (528) | 528..785 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NV952_RS23785 (878) | 878..1531 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| NV952_RS23790 (2470) | 2470..3327 | - | 858 | WP_032152935.1 | incFII family plasmid replication initiator RepA | - |
| NV952_RS23795 (3320) | 3320..3394 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| NV952_RS23800 (3630) | 3630..3887 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| NV952_RS23805 (4171) | 4171..4320 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (4364) | 4364..4425 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (4364) | 4364..4425 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (4364) | 4364..4425 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (4364) | 4364..4425 | + | 62 | NuclAT_0 | - | Antitoxin |
| NV952_RS23810 (4564) | 4564..4746 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| NV952_RS23815 (4847) | 4847..5463 | + | 617 | Protein_8 | IS1-like element IS1A family transposase | - |
| NV952_RS23820 (5501) | 5501..7072 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| NV952_RS23825 (7092) | 7092..7439 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NV952_RS23830 (7439) | 7439..8116 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| NV952_RS23835 (8171) | 8171..8260 | + | 90 | Protein_12 | IS1 family transposase | - |
| NV952_RS23840 (8561) | 8561..8773 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA | 1..54149 | 54149 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T254052 WP_001312851.1 NZ_CP102697:c4320-4171 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT254052 NZ_CP102697:4364-4425 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
