Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 25156..25425 | Replicon | plasmid pGN4554-2 |
| Accession | NZ_CP102696 | ||
| Organism | Escherichia coli strain GN4554 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | NV952_RS23515 | Protein ID | WP_001372321.1 |
| Coordinates | 25300..25425 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 25156..25221 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV952_RS23475 (20189) | 20189..20449 | + | 261 | WP_072250151.1 | hypothetical protein | - |
| NV952_RS23480 (20921) | 20921..21469 | + | 549 | WP_000290809.1 | single-stranded DNA-binding protein | - |
| NV952_RS23485 (21527) | 21527..21760 | + | 234 | WP_000006011.1 | DUF905 family protein | - |
| NV952_RS23490 (21824) | 21824..23782 | + | 1959 | WP_100039124.1 | ParB/RepB/Spo0J family partition protein | - |
| NV952_RS23495 (23837) | 23837..24271 | + | 435 | WP_032217500.1 | conjugation system SOS inhibitor PsiB | - |
| NV952_RS23500 (24268) | 24268..25030 | + | 763 | Protein_28 | plasmid SOS inhibition protein A | - |
| NV952_RS23505 (24999) | 24999..25187 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - (25156) | 25156..25221 | + | 66 | NuclAT_1 | - | - |
| - (24999) | 24999..25223 | + | 225 | NuclAT_0 | - | - |
| - (24999) | 24999..25223 | + | 225 | NuclAT_0 | - | - |
| - (24999) | 24999..25223 | + | 225 | NuclAT_0 | - | - |
| - (24999) | 24999..25223 | + | 225 | NuclAT_0 | - | - |
| - (24999) | 24999..25223 | - | 225 | NuclAT_0 | - | - |
| NV952_RS23510 (25209) | 25209..25358 | + | 150 | Protein_30 | plasmid maintenance protein Mok | - |
| NV952_RS23515 (25300) | 25300..25425 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| NV952_RS23520 (25645) | 25645..25875 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| NV952_RS23525 (25873) | 25873..26046 | - | 174 | Protein_33 | hypothetical protein | - |
| NV952_RS23530 (26116) | 26116..26322 | + | 207 | WP_000547971.1 | hypothetical protein | - |
| NV952_RS23535 (26347) | 26347..26634 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| NV952_RS23540 (26752) | 26752..27573 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| NV952_RS23545 (27870) | 27870..28517 | - | 648 | WP_000601040.1 | transglycosylase SLT domain-containing protein | - |
| NV952_RS23550 (28793) | 28793..29176 | + | 384 | WP_001151530.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| NV952_RS23555 (29368) | 29368..30015 | + | 648 | WP_000338011.1 | transcriptional regulator TraJ family protein | - |
| NV952_RS23560 (30135) | 30135..30362 | + | 228 | WP_000589558.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..67067 | 67067 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T254051 WP_001372321.1 NZ_CP102696:25300-25425 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT254051 NZ_CP102696:c25221-25156 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|