Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3868671..3868929 | Replicon | chromosome |
Accession | NZ_CP102694 | ||
Organism | Escherichia coli strain GN4554 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | NV952_RS18835 | Protein ID | WP_000809168.1 |
Coordinates | 3868777..3868929 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 3868671..3868728 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV952_RS18815 | 3863719..3865050 | + | 1332 | Protein_3675 | fimbria/pilus outer membrane usher protein | - |
NV952_RS18820 | 3865063..3866021 | + | 959 | Protein_3676 | fimbrial family protein | - |
NV952_RS18825 | 3866060..3866959 | - | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
NV952_RS18830 | 3867025..3868191 | - | 1167 | WP_000681360.1 | Na+/H+ antiporter NhaA | - |
- | 3868671..3868728 | - | 58 | - | - | Antitoxin |
NV952_RS18835 | 3868777..3868929 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
NV952_RS18840 | 3869033..3870163 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
NV952_RS18845 | 3870252..3872168 | - | 1917 | WP_000516131.1 | molecular chaperone DnaK | - |
NV952_RS18850 | 3872545..3872949 | + | 405 | WP_000843559.1 | DUF2541 family protein | - |
NV952_RS18855 | 3872975..3873688 | + | 714 | WP_001102383.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T254046 WP_000809168.1 NZ_CP102694:3868777-3868929 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT254046 NZ_CP102694:c3868728-3868671 [Escherichia coli]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|