Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1097315..1098042 | Replicon | chromosome |
| Accession | NZ_CP102694 | ||
| Organism | Escherichia coli strain GN4554 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | J7Q991 |
| Locus tag | NV952_RS05370 | Protein ID | WP_000547564.1 |
| Coordinates | 1097315..1097626 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NV952_RS05375 | Protein ID | WP_000126294.1 |
| Coordinates | 1097623..1098042 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV952_RS05340 (1092457) | 1092457..1094166 | + | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
| NV952_RS05345 (1094176) | 1094176..1094718 | + | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
| NV952_RS05350 (1094718) | 1094718..1095485 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| NV952_RS05355 (1095482) | 1095482..1095892 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
| NV952_RS05360 (1095885) | 1095885..1096355 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| NV952_RS05365 (1096380) | 1096380..1097141 | + | 762 | WP_001026446.1 | hypothetical protein | - |
| NV952_RS05370 (1097315) | 1097315..1097626 | + | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NV952_RS05375 (1097623) | 1097623..1098042 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NV952_RS05380 (1098156) | 1098156..1099580 | - | 1425 | WP_000110363.1 | 6-phospho-beta-glucosidase AscB | - |
| NV952_RS05385 (1099589) | 1099589..1101046 | - | 1458 | WP_001107861.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| NV952_RS05390 (1101306) | 1101306..1102316 | + | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
| NV952_RS05395 (1102465) | 1102465..1102992 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T254038 WP_000547564.1 NZ_CP102694:1097315-1097626 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT254038 WP_000126294.1 NZ_CP102694:1097623-1098042 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|