Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 349429..350075 | Replicon | chromosome |
Accession | NZ_CP102692 | ||
Organism | Klebsiella pneumoniae strain GN4542 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A486LFK7 |
Locus tag | NV951_RS01620 | Protein ID | WP_023301313.1 |
Coordinates | 349429..349776 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | W8UB68 |
Locus tag | NV951_RS01625 | Protein ID | WP_002920557.1 |
Coordinates | 349776..350075 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV951_RS01610 (NV951_01610) | 345355..346788 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
NV951_RS01615 (NV951_01615) | 346806..349253 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
NV951_RS01620 (NV951_01620) | 349429..349776 | + | 348 | WP_023301313.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NV951_RS01625 (NV951_01625) | 349776..350075 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NV951_RS01630 (NV951_01630) | 350138..351646 | - | 1509 | WP_049109646.1 | glycerol-3-phosphate dehydrogenase | - |
NV951_RS01635 (NV951_01635) | 351851..352180 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
NV951_RS01640 (NV951_01640) | 352231..353061 | + | 831 | WP_049109644.1 | rhomboid family intramembrane serine protease GlpG | - |
NV951_RS01645 (NV951_01645) | 353111..353869 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13506.49 Da Isoelectric Point: 6.2327
>T254017 WP_023301313.1 NZ_CP102692:349429-349776 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKETITMADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKETITMADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A486LFK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1CBF8 |