Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4295318..4296093 | Replicon | chromosome |
| Accession | NZ_CP102687 | ||
| Organism | Klebsiella pneumoniae strain GN4539 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
| Locus tag | NV950_RS21165 | Protein ID | WP_004150910.1 |
| Coordinates | 4295608..4296093 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | W8UEW1 |
| Locus tag | NV950_RS21160 | Protein ID | WP_004150912.1 |
| Coordinates | 4295318..4295611 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV950_RS21140 (NV950_21135) | 4290526..4291128 | - | 603 | WP_002916735.1 | short chain dehydrogenase | - |
| NV950_RS21145 (NV950_21140) | 4291226..4292137 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
| NV950_RS21150 (NV950_21145) | 4292138..4293286 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
| NV950_RS21155 (NV950_21150) | 4293297..4294673 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
| NV950_RS21160 (NV950_21155) | 4295318..4295611 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
| NV950_RS21165 (NV950_21160) | 4295608..4296093 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
| NV950_RS21170 (NV950_21165) | 4296797..4297390 | + | 594 | WP_004188553.1 | hypothetical protein | - |
| NV950_RS21175 (NV950_21170) | 4297487..4297703 | + | 217 | Protein_4136 | transposase | - |
| NV950_RS21180 (NV950_21175) | 4298309..4299181 | + | 873 | WP_004188557.1 | ParA family protein | - |
| NV950_RS21185 (NV950_21180) | 4299181..4299564 | + | 384 | WP_004150906.1 | hypothetical protein | - |
| NV950_RS21190 (NV950_21185) | 4299557..4300924 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 4297487..4297639 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T254012 WP_004150910.1 NZ_CP102687:4295608-4296093 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q4Q548 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GVL4 |