Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4425148..4425750 | Replicon | chromosome |
Accession | NZ_CP102679 | ||
Organism | Escherichia coli strain XH989 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NU949_RS23760 | Protein ID | WP_000897305.1 |
Coordinates | 4425439..4425750 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NU949_RS23755 | Protein ID | WP_000356397.1 |
Coordinates | 4425148..4425438 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NU949_RS23730 (4421093) | 4421093..4421995 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
NU949_RS23735 (4421992) | 4421992..4422627 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NU949_RS23740 (4422624) | 4422624..4423553 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
NU949_RS23745 (4423883) | 4423883..4424125 | - | 243 | WP_001087409.1 | protein YiiF | - |
NU949_RS23750 (4424344) | 4424344..4424562 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
NU949_RS23755 (4425148) | 4425148..4425438 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
NU949_RS23760 (4425439) | 4425439..4425750 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NU949_RS23765 (4425979) | 4425979..4426887 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
NU949_RS23770 (4426951) | 4426951..4427892 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NU949_RS23775 (4427937) | 4427937..4428374 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
NU949_RS23780 (4428371) | 4428371..4429243 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
NU949_RS23785 (4429237) | 4429237..4429836 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4423883..4433403 | 9520 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T253992 WP_000897305.1 NZ_CP102679:c4425750-4425439 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|